Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Protein S100-A9 (S10A9), Biotinylated

This Recombinant Human Protein S100-A9 (S10A9), Biotinylated spans the amino acid sequence from region 1-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Protein S100-A9; Calgranulin-B; Calprotectin L1H subunit; Leukocyte L1 complex heavy chain; Migration inhibitory factor-related protein 14; MRP-14; p14; S100 calcium-binding protein A9; S100A9 CAGB CFAG MRP14

UniProt

P06702

Expression Region

1-114

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MTCKMSQLERNIETIINTFHQYSVKLGHPDTLNQGEFKELVRKDLQNFLKKENKNEKVIEHIMEDLDTNADKQLSFEEFIMLMARLTWASHEKMHEGDEGPGHHHKPGLGEGTP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Mog (Myelin Oligodendrocyte Glycoprotein) ELISA Kit
FY-EM1943 96 Well

Mouse Mog (Myelin Oligodendrocyte Glycoprotein) ELISA Kit

Sign In for Pricing
View Details
Brooker's merocyanine dye
FB171905-01 0.1 g

Brooker's merocyanine dye

Sign In for Pricing
View Details
Brooker's merocyanine dye
FB171905-02 0.25 g

Brooker's merocyanine dye

Sign In for Pricing
View Details
Brooker's merocyanine dye
FB171905-03 0.5 g

Brooker's merocyanine dye

Sign In for Pricing
View Details
Anti-HGF Antibody
CPA7289-01 30 µL

Anti-HGF Antibody

Sign In for Pricing
View Details
Anti-HGF Antibody
CPA7289-02 50 μL

Anti-HGF Antibody

Sign In for Pricing
View Details