Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human U2 small nuclear ribonucleoprotein A' (RU2A), Biotinylated

This Recombinant Human U2 small nuclear ribonucleoprotein A' (RU2A), Biotinylated spans the amino acid sequence from region 2-255. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

U2 small nuclear ribonucleoprotein A'; U2 snRNP A'; SNRPA1

UniProt

P09661

Expression Region

2-255

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

VKLTAELIEQAAQYTNAVRDRELDLRGYKIPVIENLGATLDQFDAIDFSDNEIRKLDGFPLLRRLKTLLVNNNRICRIGEGLDQALPCLTELILTNNSLVELGDLDPLASLKSLTYLSILRNPVTNKKHYRLYVIYKVPQVRVLDFQKVKLKERQEAEKMFKGKRGAQLAKDIARRSKTFNPGAGLPTDKKKGGPSPGDVEAIKNAIANASTLAEVERLKGLLQSGQIPGRERRSGPTDDGEEEMEEDTVTNGS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

7-Bromo-5-fluoroindole
439499-01 100 mg

7-Bromo-5-fluoroindole

Sign In for Pricing
View Details
7-Bromo-5-fluoroindole
439499-02 250 mg

7-Bromo-5-fluoroindole

Sign In for Pricing
View Details
SPINK4 (NM_014471) Human Recombinant Protein
E45H30204E1 50 µg

SPINK4 (NM_014471) Human Recombinant Protein

Sign In for Pricing
View Details
Ladiratuzumab vedotin
C00998-1mg 1 mg

Ladiratuzumab vedotin

Sign In for Pricing
View Details
Angular rotor
E2733 1 Unit

Angular rotor

Sign In for Pricing
View Details
Recombinant Human CD14 CHO
MBS143087-01 0.01 mg

Recombinant Human CD14 CHO

Sign In for Pricing
View Details