Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Pepsin A-3 (PEPA3), Biotinylated

This Recombinant Human Pepsin A-3 (PEPA3), Biotinylated spans the amino acid sequence from region 63-388. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Pepsin A-3; EC 3.4.23.1; Pepsinogen-3; PGA3

UniProt

P0DJD8

Expression Region

63-388

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

VDEQPLENYLDMEYFGTIGIGTPAQDFTVVFDTGSSNLWVPSVYCSSLACTNHNRFNPEDSSTYQSTSETVSITYGTGSMTGILGYDTVQVGGISDTNQIFGLSETEPGSFLYYAPFDGILGLAYPSISSSGATPVFDNIWNQGLVSQDLFSVYLSADDQSGSVVIFGGIDSSYYTGSLNWVPVTVEGYWQITVDSITMNGEAIACAEGCQAIVDTGTSLLTGPTSPIANIQSDIGASENSDGDMVVSCSAISSLPDIVFTINGVQYPVPPSAYILQSEGSCISGFQGMNLPTESGELWILGDVFIRQYFTVFDRANNQVGLAPVA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Lactobacillus salivarius Glutamate 5-kinase (proB)
MBS1418070-01 0.02 mg (E-Coli)

Recombinant Lactobacillus salivarius Glutamate 5-kinase (proB)

Sign In for Pricing
View Details
Recombinant Lactobacillus salivarius Glutamate 5-kinase (proB)
MBS1418070-02 0.02 mg (Yeast)

Recombinant Lactobacillus salivarius Glutamate 5-kinase (proB)

Sign In for Pricing
View Details
Recombinant Lactobacillus salivarius Glutamate 5-kinase (proB)
MBS1418070-03 0.1 mg (E-Coli)

Recombinant Lactobacillus salivarius Glutamate 5-kinase (proB)

Sign In for Pricing
View Details
Recombinant Lactobacillus salivarius Glutamate 5-kinase (proB)
MBS1418070-04 0.1 mg (Yeast)

Recombinant Lactobacillus salivarius Glutamate 5-kinase (proB)

Sign In for Pricing
View Details
Recombinant Lactobacillus salivarius Glutamate 5-kinase (proB)
MBS1418070-05 0.02 mg (Baculovirus)

Recombinant Lactobacillus salivarius Glutamate 5-kinase (proB)

Sign In for Pricing
View Details
Recombinant Lactobacillus salivarius Glutamate 5-kinase (proB)
MBS1418070-06 0.02 mg (Mammalian-Cell)

Recombinant Lactobacillus salivarius Glutamate 5-kinase (proB)

Sign In for Pricing
View Details