Recombinant Human Transmembrane domain-containing protein TMIGD3 (TMIG3), partial, Biotinylated
This Recombinant Human Transmembrane domain-containing protein TMIGD3 (TMIG3), partial, Biotinylated spans the amino acid sequence from region 76-212. Purity: Greater than 85% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Transmembrane domain-containing protein TMIGD3 TMIGD3 UNQ1931/PRO4406
UniProt
P0DMS9
Expression Region
76-212
Origin
Homo sapiens (Human)
Endotoxin
Not test
Purity
Greater than 85% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Storage Conditions
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
AA Sequence
MDEKVKRSFVLDTASAICNYNAHYKNHPKYWCRGYFRDYCNIIAFSPNSTNHVALRDTGNQLIVTMSCLTKEDTGWYWCGIQRDFARDDMDFTELIVTDDKGTLANDFWSGKDLSGNKTRSCKAPKVVRKADRSRTS
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
NBP3-20829DL594 0.1 mL
Mouse Monoclonal alpha 2-Macroglobulin Antibody (A2M/6556) [DyLight 594]
Sign In for Pricing
View Details 