Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Choriogonadotropin subunit beta 3 (CGB3), Biotinylated

This Recombinant Human Choriogonadotropin subunit beta 3 (CGB3), Biotinylated spans the amino acid sequence from region 21-165. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Choriogonadotropin subunit beta 3; Choriogonadotropin subunit beta; CG-beta; Chorionic gonadotropin chain beta; CGB3 CGB; CGB5; CGB8

UniProt

P0DN86

Expression Region

21-165

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

SKEPLRPRCRPINATLAVEKEGCPVCITVNTTICAGYCPTMTRVLQGVLPALPQVVCNYRDVRFESIRLPGCPRGVNPVVSYAVALSCQCALCRRSTTDCGGPKDHPLTCDDPRFQDSSSSKAPPPSLPSPSRLPGPSDTPILPQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF780B ORF Vector (Human) (pORF)
51830011 1.0 µg DNA

ZNF780B ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Malectin (mLEC) (NM_014730) Human Over-expression Lysate
LY415102 100 µg

Malectin (mLEC) (NM_014730) Human Over-expression Lysate

Sign In for Pricing
View Details
IGF1 Receptor (IGF1R) Mouse Monoclonal Antibody [Clone ID: OTI4C4]
CF807835 100 µg

IGF1 Receptor (IGF1R) Mouse Monoclonal Antibody [Clone ID: OTI4C4]

Sign In for Pricing
View Details
Human Prokineticin Receptor 1 ELISA Kit
IHUPKR1KT 1 Each

Human Prokineticin Receptor 1 ELISA Kit

Sign In for Pricing
View Details
4732415M23Rik sgRNA CRISPR Lentivector (Mouse) (Target 1)
K3250602 1.0 µg DNA

4732415M23Rik sgRNA CRISPR Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
RPLP0P6 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
LV781567 1.0 µg DNA

RPLP0P6 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)

Sign In for Pricing
View Details