Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin lambda constant 2 (IGLC2), Biotinylated

This Recombinant Human Immunoglobulin lambda constant 2 (IGLC2), Biotinylated spans the amino acid sequence from region 1-106. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin lambda constant 2; Ig lambda chain C region Kern; Ig lambda chain C region NIG-64; Ig lambda chain C region SH; Ig lambda chain C region X; Ig lambda-2 chain C region; IGLC2

UniProt

P0DOY2

Expression Region

1-106

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NIFK (NM_032390) Human Tagged ORF Clone Lentiviral Particle
RC205961L3V 200 µL

NIFK (NM_032390) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
MD-1 Double Nickase Plasmid (h2)
sc-411282-NIC-2 20 µg

MD-1 Double Nickase Plasmid (h2)

Sign In for Pricing
View Details
LRC18, CT (LRRC18, Leucine-rich repeat-containing protein 18) (AP) discontinued
037919-AP 200 µL

LRC18, CT (LRRC18, Leucine-rich repeat-containing protein 18) (AP) discontinued

Sign In for Pricing
View Details
PHF10 (NM_018288) Human Over-expression Lysate
LC413136 20 µg

PHF10 (NM_018288) Human Over-expression Lysate

Sign In for Pricing
View Details
ZNF651 (ZBTB47) (NM_145166) Human Untagged Clone
SC321671 10 µg

ZNF651 (ZBTB47) (NM_145166) Human Untagged Clone

Sign In for Pricing
View Details
Thumpd1 Mouse siRNA Oligo Duplex (Locus ID 233802)
SR411799 1 Kit

Thumpd1 Mouse siRNA Oligo Duplex (Locus ID 233802)

Sign In for Pricing
View Details