Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin lambda constant 3 (IGLC3), Biotinylated

This Recombinant Human Immunoglobulin lambda constant 3 (IGLC3), Biotinylated spans the amino acid sequence from region 1-106. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin lambda constant 3; Ig lambda chain C region DOT; Ig lambda chain C region NEWM; Ig lambda-3 chain C regions; IGLC3

UniProt

P0DOY3

Expression Region

1-106

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHKSYSCQVTHEGSTVEKTVAPTECS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SARS-CoV-2 (COVID-19) Nucleocapsid Antibody
9103-01mg 0.1 mg

SARS-CoV-2 (COVID-19) Nucleocapsid Antibody

Sign In for Pricing
View Details
Lentiviral human EDN2 shRNA (UAS) - Lentiviral human EDN2 shRNA (UAS) (100)
GTR15337545 1 Vial

Lentiviral human EDN2 shRNA (UAS) - Lentiviral human EDN2 shRNA (UAS) (100)

Sign In for Pricing
View Details
NUDT10-set siRNA/shRNA/RNAi Lentivector (Human)
32276091 4x 500 ng

NUDT10-set siRNA/shRNA/RNAi Lentivector (Human)

Sign In for Pricing
View Details
Tigd2 3'UTR GFP Stable Cell Line
TU170489 1.0 mL

Tigd2 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Acarbose123
296669-01 250 mg

Acarbose123

Sign In for Pricing
View Details
Acarbose123
296669-02 500 mg

Acarbose123

Sign In for Pricing
View Details