Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Secreted Ly-6/uPAR domain-containing protein 2 (SLUR2), Biotinylated

This Recombinant Human Secreted Ly-6/uPAR domain-containing protein 2 (SLUR2), Biotinylated spans the amino acid sequence from region 23-97. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Secreted Ly-6/uPAR domain-containing protein 2; Secreted LY6/PLAUR domain-containing protein 2; Secreted Ly-6/uPAR-related protein 2; SLURP-2; SLURP2

UniProt

P0DP57

Expression Region

23-97

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

IWCHQCTGFGGCSHGSRCLRDSTHCVTTATRVLSNTEDLPLVTKMCHIGCPDIPSLGLGPYVSIACCQTSLCNHD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CLDN25 Recombinant Protein (Human)
RP052342 100 µg

CLDN25 Recombinant Protein (Human)

Sign In for Pricing
View Details
PARP1 Rabbit mAb Antibody
orb3015040 100 µL

PARP1 Rabbit mAb Antibody

Sign In for Pricing
View Details
HGF R/c-MET Overexpression Lysate (Native) - (Dry Ice)
NBL1-13017 0.1 mg

HGF R/c-MET Overexpression Lysate (Native) - (Dry Ice)

Sign In for Pricing
View Details
MACC1 Antibody, FITC conjugated
CSB-PA761627LC01HU-01 50 µg

MACC1 Antibody, FITC conjugated

Sign In for Pricing
View Details
MACC1 Antibody, FITC conjugated
CSB-PA761627LC01HU-02 100 µg

MACC1 Antibody, FITC conjugated

Sign In for Pricing
View Details
MOSPD2, NT (MOSPD2, Motile sperm domain-containing protein 2) (MaxLight 490) discontinued
038551-ML490 100 µL

MOSPD2, NT (MOSPD2, Motile sperm domain-containing protein 2) (MaxLight 490) discontinued

Sign In for Pricing
View Details