Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Endothelin-converting enzyme 2 (ECE2), partial, Biotinylated

This Recombinant Human Endothelin-converting enzyme 2 (ECE2), partial, Biotinylated spans the amino acid sequence from region 1-106. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Endothelin-converting enzyme 2; ECE-2; EC 3.4.24.71; ECE2 KIAA0604 UNQ403/PRO740

UniProt

P0DPD6

Expression Region

1-106

Origin

Homo sapiens (Human)

Field of Research

Protein Biochemistry

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MNVALQELGAGSNMVEYKRATLRDEDAPETPVEGGASPDAMEVGKGASPFSPGPSPGMTPGTPRSSGLFWRVTCPHLRSISGLCSRTMVGFQKGTRQLLGSRTQLE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AdmiRa-Off-hsa-miR-6875-3p Virus
mh7421 1.0 mL

AdmiRa-Off-hsa-miR-6875-3p Virus

Sign In for Pricing
View Details
MAPK11 (NM_002751) Human Untagged Clone
SC118466 10 µg

MAPK11 (NM_002751) Human Untagged Clone

Sign In for Pricing
View Details
Phospho-RAF1 (Ser259) Antibody
A49785-100UL 100 µL

Phospho-RAF1 (Ser259) Antibody

Sign In for Pricing
View Details
NAT8B (NM_016347) Human Tagged Lenti ORF Clone
RC215647L4 10 µg

NAT8B (NM_016347) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
IFluor® 810 goat anti-rabbit IgG (H+L)
48054-AAT 200 µg

IFluor® 810 goat anti-rabbit IgG (H+L)

Sign In for Pricing
View Details
PDGF-BB Protein (Active)
MBS355607-01 0.01 mg

PDGF-BB Protein (Active)

Sign In for Pricing
View Details