Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Endothelin-converting enzyme 2 (ECE2), partial, Biotinylated

This Recombinant Human Endothelin-converting enzyme 2 (ECE2), partial, Biotinylated spans the amino acid sequence from region 1-106. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Endothelin-converting enzyme 2; ECE-2; EC 3.4.24.71; ECE2 KIAA0604 UNQ403/PRO740

UniProt

P0DPD6

Expression Region

1-106

Origin

Homo sapiens (Human)

Field of Research

Protein Biochemistry

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MNVALQELGAGSNMVEYKRATLRDEDAPETPVEGGASPDAMEVGKGASPFSPGPSPGMTPGTPRSSGLFWRVTCPHLRSISGLCSRTMVGFQKGTRQLLGSRTQLE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GCP2 (F-3) : m-IgGκ BP-HRP Bundle
sc-523194 1 Kit

GCP2 (F-3) : m-IgGκ BP-HRP Bundle

Sign In for Pricing
View Details
PTK2, Phosphorylated (Y397) (Protein-tyrosine Kinase 2, FAK, FADK, FAK1, FRNK, PPP1R71, p125FAK, pp125FAK) (MaxLight 490)
MBS6434037-01 0.1 mL

PTK2, Phosphorylated (Y397) (Protein-tyrosine Kinase 2, FAK, FADK, FAK1, FRNK, PPP1R71, p125FAK, pp125FAK) (MaxLight 490)

Sign In for Pricing
View Details
PTK2, Phosphorylated (Y397) (Protein-tyrosine Kinase 2, FAK, FADK, FAK1, FRNK, PPP1R71, p125FAK, pp125FAK) (MaxLight 490)
MBS6434037-02 5x 0.1 mL

PTK2, Phosphorylated (Y397) (Protein-tyrosine Kinase 2, FAK, FADK, FAK1, FRNK, PPP1R71, p125FAK, pp125FAK) (MaxLight 490)

Sign In for Pricing
View Details
Canine heart fatty acid binding protein, h-FABP ELISA KIT
E0307Ca-01 48 Well

Canine heart fatty acid binding protein, h-FABP ELISA KIT

Sign In for Pricing
View Details
Canine heart fatty acid binding protein, h-FABP ELISA KIT
E0307Ca-02 96 Well

Canine heart fatty acid binding protein, h-FABP ELISA KIT

Sign In for Pricing
View Details
Canine heart fatty acid binding protein, h-FABP ELISA KIT
E0307Ca-03 5x 96 Tests

Canine heart fatty acid binding protein, h-FABP ELISA KIT

Sign In for Pricing
View Details