Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Histone H3.Y (H3Y1), Biotinylated

This Recombinant Human Histone H3.Y (H3Y1), Biotinylated spans the amino acid sequence from region 2-136. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Histone H3.Y; Histone H3.Y1; H3Y1

UniProt

P0DPK2

Expression Region

2-136

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

ARTKQTARKATAWQAPRKPLATKAAGKRAPPTGGIKKPHRYKPGTLALREIRKYQKSTQLLLRKLPFQRLVREIAQAISPDLRFQSAAIGALQEASEAYLVQLFEDTNLCAIHARRVTIMPRDMQLARRLRREGP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KIAA1024 Lentiviral Activation Particles (h2)
sc-409841-LAC-2 200 µL

KIAA1024 Lentiviral Activation Particles (h2)

Sign In for Pricing
View Details
Paper filter disc diam.110mm fast qualitative 07 8-12um retention GVS 100 pc
FP110DME07QALC01 100 Pieces/Case:100 Pieces/ PACKS:1 PACKS/CASE

Paper filter disc diam.110mm fast qualitative 07 8-12um retention GVS 100 pc

Sign In for Pricing
View Details
Rabbit Polyclonal FoxJ3 Antibody [Janelia Fluor 646]
NBP1-71862JF646 0.1 mL

Rabbit Polyclonal FoxJ3 Antibody [Janelia Fluor 646]

Sign In for Pricing
View Details
Anti-SMTN Antibody Picoband® Fluoro647 Conjugated
A04895-2-Fluoro647 100 µg/Vial

Anti-SMTN Antibody Picoband® Fluoro647 Conjugated

Sign In for Pricing
View Details
Olr45-set siRNA/shRNA/RNAi Lentivector (Rat)
34416096 4x 500 ng

Olr45-set siRNA/shRNA/RNAi Lentivector (Rat)

Sign In for Pricing
View Details
Zfp598 ORF Vector (Mouse) (pORF)
ORF062449 1.0 µg DNA

Zfp598 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details