Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Alpha-amylase 1B (AMY1B), Biotinylated

This Recombinant Human Alpha-amylase 1B (AMY1B), Biotinylated spans the amino acid sequence from region 16-511. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Alpha-amylase 1B; EC 3.2.1.1; AMY1B AMY1

UniProt

P0DTE7

Expression Region

16-511

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QYSSNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIHNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLSGLLDLALGKDYVRSKIAEYMNHLIDIGVAGFRIDASKHMWPGDIKAILDKLHNLNSNWFPEGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFMPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWPRYFENGKDVNDWVGPPNDNGVTKEVTINPDTTCGNDWVCEHRWRQIRNMVNFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWTFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Interleukin 13 Receptor Alpha 2 (IL13Ra2) ELISA Kit
DLR-IL13Ra2-Hu-96T 96 Tests

Human Interleukin 13 Receptor Alpha 2 (IL13Ra2) ELISA Kit

Sign In for Pricing
View Details
MBIP CRISPRa sgRNA lentivector (set of three targets)(Rat)
28170126 3x 1.0µg DNA

MBIP CRISPRa sgRNA lentivector (set of three targets)(Rat)

Sign In for Pricing
View Details
Rabbit polyclonal anti-Rad52 antibody
TA353424L 500 µL

Rabbit polyclonal anti-Rad52 antibody

Sign In for Pricing
View Details
Anti-Superoxide Dismutase 3/EC-SOD/Sod3 Antibody Picoband
MBS1754983-01 0.01 mg

Anti-Superoxide Dismutase 3/EC-SOD/Sod3 Antibody Picoband

Sign In for Pricing
View Details
Anti-Superoxide Dismutase 3/EC-SOD/Sod3 Antibody Picoband
MBS1754983-02 0.1 mg (Carrier Free)

Anti-Superoxide Dismutase 3/EC-SOD/Sod3 Antibody Picoband

Sign In for Pricing
View Details
Anti-Superoxide Dismutase 3/EC-SOD/Sod3 Antibody Picoband
MBS1754983-03 0.1 mg

Anti-Superoxide Dismutase 3/EC-SOD/Sod3 Antibody Picoband

Sign In for Pricing
View Details