Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Alpha-amylase 1C (AMY1C), Biotinylated

This Recombinant Human Alpha-amylase 1C (AMY1C), Biotinylated spans the amino acid sequence from region 16-511. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Alpha-amylase 1C; EC 3.2.1.1; AMY1C AMY1

UniProt

P0DTE8

Expression Region

16-511

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QYSSNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIHNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLSGLLDLALGKDYVRSKIAEYMNHLIDIGVAGFRIDASKHMWPGDIKAILDKLHNLNSNWFPEGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFMPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWPRYFENGKDVNDWVGPPNDNGVTKEVTINPDTTCGNDWVCEHRWRQIRNMVNFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWTFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Camkk2 sgRNA CRISPR Lentivector set (Mouse)
K4698801 3x 1.0 µg

Camkk2 sgRNA CRISPR Lentivector set (Mouse)

Sign In for Pricing
View Details
Phospho-CHEK2 (Thr68) Polyclonal Antibody, AbBy Fluor™ 647 Conjugated
bs-3721R-BF647-01 20 µL

Phospho-CHEK2 (Thr68) Polyclonal Antibody, AbBy Fluor™ 647 Conjugated

Sign In for Pricing
View Details
Phospho-CHEK2 (Thr68) Polyclonal Antibody, AbBy Fluor™ 647 Conjugated
bs-3721R-BF647-02 100 µL

Phospho-CHEK2 (Thr68) Polyclonal Antibody, AbBy Fluor™ 647 Conjugated

Sign In for Pricing
View Details
H6PD Rabbit Polyclonal Antibody
orb514874 100 µg

H6PD Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
KRT17P2 sgRNA CRISPR Lentivector (Human) (Target 1)
K1169902 1.0 µg DNA

KRT17P2 sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
Recombinant Human Peroxiredoxin-1 (PRDX1)
CSB-EP018653HU-01 10 µg

Recombinant Human Peroxiredoxin-1 (PRDX1)

Sign In for Pricing
View Details