Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Alpha-amylase 1A (AMY1A), Biotinylated

This Recombinant Human Alpha-amylase 1A (AMY1A), Biotinylated spans the amino acid sequence from region 16-511. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Alpha-amylase 1A; EC 3.2.1.1; 1,4-alpha-D-glucan glucanohydrolase 1; Salivary alpha-amylase; AMY1A AMY1

UniProt

P0DUB6

Expression Region

16-511

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QYSSNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIHNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLSGLLDLALGKDYVRSKIAEYMNHLIDIGVAGFRIDASKHMWPGDIKAILDKLHNLNSNWFPEGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFMPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWPRYFENGKDVNDWVGPPNDNGVTKEVTINPDTTCGNDWVCEHRWRQIRNMVNFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWTFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Toll-like receptor 3 (TLR3) ELISA Kit
AE14865RA-01 48 Tests

Rat Toll-like receptor 3 (TLR3) ELISA Kit

Sign In for Pricing
View Details
Rat Toll-like receptor 3 (TLR3) ELISA Kit
AE14865RA-02 96 Tests

Rat Toll-like receptor 3 (TLR3) ELISA Kit

Sign In for Pricing
View Details
Gzf1 Rat shRNA Plasmid (Locus ID 311508)
TR706337 1 Kit

Gzf1 Rat shRNA Plasmid (Locus ID 311508)

Sign In for Pricing
View Details
AQP1 Polyclonal Antibody
E20-70287 100 µg

AQP1 Polyclonal Antibody

Sign In for Pricing
View Details
LysoFos Choline Ether 16
MPD0136K Each

LysoFos Choline Ether 16

Sign In for Pricing
View Details
B4GALT5 Antibody - middle region
MBS3220482-01 0.1 mL

B4GALT5 Antibody - middle region

Sign In for Pricing
View Details