Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Alpha-amylase 1A (AMY1A), Biotinylated

This Recombinant Human Alpha-amylase 1A (AMY1A), Biotinylated spans the amino acid sequence from region 16-511. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Alpha-amylase 1A; EC 3.2.1.1; 1,4-alpha-D-glucan glucanohydrolase 1; Salivary alpha-amylase; AMY1A AMY1

UniProt

P0DUB6

Expression Region

16-511

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QYSSNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIHNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLSGLLDLALGKDYVRSKIAEYMNHLIDIGVAGFRIDASKHMWPGDIKAILDKLHNLNSNWFPEGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFMPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWPRYFENGKDVNDWVGPPNDNGVTKEVTINPDTTCGNDWVCEHRWRQIRNMVNFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWTFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sytl1 ORF Vector (Rat) (pORF)
46011016 1.0 µg DNA

Sytl1 ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
Ebf4 Rabbit Polyclonal Antibody (FITC)
orb2130412 100 µL

Ebf4 Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
Heme oxygenase 1 Polyclonal Antibody, AbBy Fluor™ 594 Conjugated
bs-2075R-BF594-01 20 µL

Heme oxygenase 1 Polyclonal Antibody, AbBy Fluor™ 594 Conjugated

Sign In for Pricing
View Details
Heme oxygenase 1 Polyclonal Antibody, AbBy Fluor™ 594 Conjugated
bs-2075R-BF594-02 100 µL

Heme oxygenase 1 Polyclonal Antibody, AbBy Fluor™ 594 Conjugated

Sign In for Pricing
View Details
Tbxa2r sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)
K6860808 1.0 µg DNA

Tbxa2r sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details
RAD26L (ERCC6L2) (NM_020207) Human Over-expression Lysate
LC412592 20 µg

RAD26L (ERCC6L2) (NM_020207) Human Over-expression Lysate

Sign In for Pricing
View Details