Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Uridine 5'-monophosphate synthase (UMPS), Biotinylated

This Recombinant Human Uridine 5'-monophosphate synthase (UMPS), Biotinylated spans the amino acid sequence from region 2-480. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Uridine 5'-monophosphate synthase; UMP synthase; [Includes: Orotate phosphoribosyltransferase; OPRT; OPRTase; EC 2.4.2.10; Orotidine 5'-phosphate decarboxylase; ODC; OMPD; EC 4.1.1.23; OMPdecase] UMPS OK/SW-cl.21

UniProt

P11172

Expression Region

2-480

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

AVARAALGPLVTGLYDVQAFKFGDFVLKSGLSSPIYIDLRGIVSRPRLLSQVADILFQTAQNAGISFDTVCGVPYTALPLATVICSTNQIPMLIRRKETKDYGTKRLVEGTINPGETCLIIEDVVTSGSSVLETVEVLQKEGLKVTDAIVLLDREQGGKDKLQAHGIRLHSVCTLSKMLEILEQQKKVDAETVGRVKRFIQENVFVAANHNGSPLSIKEAPKELSFGARAELPRIHPVASKLLRLMQKKETNLCLSADVSLARELLQLADALGPSICMLKTHVDILNDFTLDVMKELITLAKCHEFLIFEDRKFADIGNTVKKQYEGGIFKIASWADLVNAHVVPGSGVVKGLQEVGLPLHRGCLLIAEMSSTGSLATGDYTRAAVRMAEEHSEFVVGFISGSRVSMKPEFLHLTPGVQLEAGGDNLGQQYNSPQEVIGKRGSDIIIVGRGIISAADRLEAAEMYRKAAWEAYLSRLGV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal HYPB Antibody
NBP2-98651-100ul 100 µL

Rabbit Polyclonal HYPB Antibody

Sign In for Pricing
View Details
GRK6-IN-1
BA5340-10 10 mg

GRK6-IN-1

Sign In for Pricing
View Details
MTREX (NM_015360) Human Over-expression Lysate
LY414597 100 µg

MTREX (NM_015360) Human Over-expression Lysate

Sign In for Pricing
View Details
KRTAP6-2 CRISPRa sgRNA lentivector (set of three targets)(Mouse)
26208124 3x 1.0µg DNA

KRTAP6-2 CRISPRa sgRNA lentivector (set of three targets)(Mouse)

Sign In for Pricing
View Details
KMT6 (9T17) Rabbit Monoclonal Antibody
E28M0737 100 µL

KMT6 (9T17) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
SCYE1 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)
LV811154 1.0 µg DNA

SCYE1 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details