Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Creatine kinase B-type (KCRB), Biotinylated

This Recombinant Human Creatine kinase B-type (KCRB), Biotinylated spans the amino acid sequence from region 2-381. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Creatine kinase B-type; EC 2.7.3.2; Brain creatine kinase; B-CK; Creatine kinase B chain; Creatine phosphokinase B-type; CPK-B; CKB CKBB

UniProt

P12277

Expression Region

2-381

Origin

Homo sapiens (Human)

Field of Research

Pharmacology & Drug Discovery

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

PFSNSHNALKLRFPAEDEFPDLSAHNNHMAKVLTPELYAELRAKSTPSGFTLDDVIQTGVDNPGHPYIMTVGCVAGDEESYEVFKDLFDPIIEDRHGGYKPSDEHKTDLNPDNLQGGDDLDPNYVLSSRVRTGRSIRGFCLPPHCSRGERRAIEKLAVEALSSLDGDLAGRYYALKSMTEAEQQQLIDDHFLFDKPVSPLLLASGMARDWPDARGIWHNDNKTFLVWVNEEDHLRVISMQKGGNMKEVFTRFCTGLTQIETLFKSKDYEFMWNPHLGYILTCPSNLGTGLRAGVHIKLPNLGKHEKFSEVLKRLRLQKRGTGGVDTAAVGGVFDVSNADRLGFSEVELVQMVVDGVKLLIEMEQRLEQGQAIDDLMPAQK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD81 / TAPA-1 (rC81/3442), CF640R conjugate, 0.1mg/mL
BNC403442-500 1x 500 µL

CD81 / TAPA-1 (rC81/3442), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
SARS-CoV-2 Nucleocapsid Protein ELISA Kit
E-EL-E604 96 Tests

SARS-CoV-2 Nucleocapsid Protein ELISA Kit

Sign In for Pricing
View Details
Tissue Protein Lysate, Lung
CP565828 150 µg

Tissue Protein Lysate, Lung

Sign In for Pricing
View Details
Josephin 1 (JOSD1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3B11]
TA502210BM 100 µL

Josephin 1 (JOSD1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3B11]

Sign In for Pricing
View Details
Recombinant AHCY Antibody
RC-16453-01 50 μL

Recombinant AHCY Antibody

Sign In for Pricing
View Details
Recombinant AHCY Antibody
RC-16453-02 100 µL

Recombinant AHCY Antibody

Sign In for Pricing
View Details