Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Inosine-5'-monophosphate dehydrogenase 1 (IMDH1), Biotinylated

This Recombinant Human Inosine-5'-monophosphate dehydrogenase 1 (IMDH1), Biotinylated spans the amino acid sequence from region 2-514. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Inosine-5'-monophosphate dehydrogenase 1; IMP dehydrogenase 1; IMPD 1; IMPDH 1; EC 1.1.1.205; IMPDH-I; IMPDH1 IMPD1

UniProt

P20839

Expression Region

2-514

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research; Pharmacology & Drug Discovery

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

ADYLISGGTGYVPEDGLTAQQLFASADGLTYNDFLILPGFIDFIADEVDLTSALTRKITLKTPLISSPMDTVTEADMAIAMALMGGIGFIHHNCTPEFQANEVRKVKKFEQGFITDPVVLSPSHTVGDVLEAKMRHGFSGIPITETGTMGSKLVGIVTSRDIDFLAEKDHTTLLSEVMTPRIELVVAPAGVTLKEANEILQRSKKGKLPIVNDCDELVAIIARTDLKKNRDYPLASKDSQKQLLCGAAVGTREDDKYRLDLLTQAGVDVIVLDSSQGNSVYQIAMVHYIKQKYPHLQVIGGNVVTAAQAKNLIDAGVDGLRVGMGCGSICITQEVMACGRPQGTAVYKVAEYARRFGVPIIADGGIQTVGHVVKALALGASTVMMGSLLAATTEAPGEYFFSDGVRLKKYRGMGSLDAMEKSSSSQKRYFSEGDKVKIAQGVSGSIQDKGSIQKFVPYLIAGIQHGCQDIGARSLSVLRSMMYSGELKFEKRTMSAQIEGGVHGLHSYEKRLY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal SPPL2a (N-Terminal) Antibody (Human)
B2024444 100 µg

Rabbit Polyclonal SPPL2a (N-Terminal) Antibody (Human)

Sign In for Pricing
View Details
Spry2 3'UTR GFP Stable Cell Line
TU169649 1.0 mL

Spry2 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Cxxc4 Mouse siRNA Oligo Duplex (Locus ID 319478)
SR405004 1 Kit

Cxxc4 Mouse siRNA Oligo Duplex (Locus ID 319478)

Sign In for Pricing
View Details
CEACAM21 Antibody
MBS9402177-01 0.1 mL

CEACAM21 Antibody

Sign In for Pricing
View Details
CEACAM21 Antibody
MBS9402177-02 5x 0.1 mL

CEACAM21 Antibody

Sign In for Pricing
View Details
(±) -Camphor-10-sulfonic acid (Standard)
HY-W012218R-01 10 mg

(±) -Camphor-10-sulfonic acid (Standard)

Sign In for Pricing
View Details