Recombinant Human Cone cGMP-specific 3',5'-cyclic phosphodiesterase subunit alpha' (PDE6C), partial, Biotinylated
This Recombinant Human Cone cGMP-specific 3',5'-cyclic phosphodiesterase subunit alpha' (PDE6C), partial, Biotinylated spans the amino acid sequence from region 486-819. Purity: Greater than 85% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Cone cGMP-specific 3',5'-cyclic phosphodiesterase subunit alpha'; EC 3.1.4.35; cGMP phosphodiesterase 6C; PDE6C PDEA2
UniProt
P51160
Expression Region
486-819
Origin
Homo sapiens (Human)
Field of Research
Signal Transduction
Endotoxin
Not test
Purity
Greater than 85% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Storage Conditions
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
AA Sequence
EEKQLVAILKEDLPDPRSAELYEFRFSDFPLTEHGLIKCGIRLFFEINVVEKFKVPVEVLTRWMYTVRKGYRAVTYHNWRHGFNVGQTMFTLLMTGRLKKYYTDLEAFAMLAAAFCHDIDHRGTNNLYQMKSTSPLARLHGSSILERHHLEYSKTLLQDESLNIFQNLNKRQFETVIHLFEVAIIATDLALYFKKRTMFQKIVDACEQMQTEEEAIKYVTVDPTKKEIIMAMMMTACDLSAITKPWEVQSQVALMVANEFWEQGDLERTVLQQQPIPMMDRNKRDELPKLQVGFIDFVCTFVYKEFSRFHKEITPMLSGLQNNRVEWKSLADEY
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
TL306961V 500 µL Each
C2CD3 Human shRNA Lentiviral Particle (Locus ID 26005)
Sign In for Pricing
View Details 