Recombinant Human 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-2 (PLCB2), partial, Biotinylated
This Recombinant Human 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-2 (PLCB2), partial, Biotinylated spans the amino acid sequence from region 312-463. Purity: Greater than 85% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-2; EC 3.1.4.11; Phosphoinositide phospholipase C-beta-2; Phospholipase C-beta-2; PLC-beta-2; PLCB2
UniProt
Q00722
Expression Region
312-463
Origin
Homo sapiens (Human)
Field of Research
Metabolism Research
Endotoxin
Not test
Purity
Greater than 85% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Storage Conditions
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
AA Sequence
HDMTQPLNHYFINSSHNTYLTAGQFSGLSSAEMYRQVLLSGCRCVELDCWKGKPPDEEPIITHGFTMTTDIFFKEAIEAIAESAFKTSPYPIILSFENHVDSPRQQAKMAEYCRTIFGDMLLTEPLEKFPLKPGVPLPSPEDLRGKILIKNK
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS6123299-01 0.1 mL
HSP60 (Heat Shock Protein 60, 60kD chaperonin, 60kD heat shock protein mitochondrial, Chaperonin, 60-KD (CPN60), GROEL, HLD4, HSP65, HSPD1, HuCHA60, Mitochondrial matrix protein P1, P60 lymphocyte protein, Short heat shock protein 60 Hsp60s1, Spastic para
Sign In for Pricing
View Details MBS6123299-02 5x 0.1 mL
HSP60 (Heat Shock Protein 60, 60kD chaperonin, 60kD heat shock protein mitochondrial, Chaperonin, 60-KD (CPN60), GROEL, HLD4, HSP65, HSPD1, HuCHA60, Mitochondrial matrix protein P1, P60 lymphocyte protein, Short heat shock protein 60 Hsp60s1, Spastic para
Sign In for Pricing
View Details 
GTR15179114 1 Vial
Lentiviral mouse Gsg1l shRNA (UAS) - Lentiviral mouse Gsg1l shRNA (UAS, iRFP) (25)
Sign In for Pricing
View Details