Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Receptor expression-enhancing protein 5 (REEP5), partial, Biotinylated

This Recombinant Human Receptor expression-enhancing protein 5 (REEP5), partial, Biotinylated spans the amino acid sequence from region 124-189. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Receptor expression-enhancing protein 5; Polyposis locus protein 1; Protein TB2; REEP5 C5orf18 DP1 TB2

UniProt

Q00765

Expression Region

124-189

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

CMAPSPSNGAELLYKRIIRPFFLKHESQMDSVVKDLKDKAKETADAITKEAKKATVNLLGEEKKST

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Automation Reservoirs
RES10SW-FLAT 50 Pack/Case

Automation Reservoirs

Sign In for Pricing
View Details
BRG1 Recombinant Mouse Monoclonal Antibody [A5C9-R]
HA601345 100 µL

BRG1 Recombinant Mouse Monoclonal Antibody [A5C9-R]

Sign In for Pricing
View Details
Tissue FFPE Sections, Prostate
CS702024 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details
CTBP1 (NM_001328) Human Over-expression Lysate
LC400528 20 µg

CTBP1 (NM_001328) Human Over-expression Lysate

Sign In for Pricing
View Details
D Box Binding Protein (DBP) Human Gene Knockout Kit (CRISPR)
KN402051 1 Kit

D Box Binding Protein (DBP) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
DCP1A Polyclonal Antibody
E-AB-11140-01 20 µL

DCP1A Polyclonal Antibody

Sign In for Pricing
View Details