Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Receptor expression-enhancing protein 5 (REEP5), partial, Biotinylated

This Recombinant Human Receptor expression-enhancing protein 5 (REEP5), partial, Biotinylated spans the amino acid sequence from region 124-189. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Receptor expression-enhancing protein 5; Polyposis locus protein 1; Protein TB2; REEP5 C5orf18 DP1 TB2

UniProt

Q00765

Expression Region

124-189

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

CMAPSPSNGAELLYKRIIRPFFLKHESQMDSVVKDLKDKAKETADAITKEAKKATVNLLGEEKKST

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

1,4-Phenylenediacetic Acid Ethyl Ester
TRC-P319730-250MG 250 mg

1,4-Phenylenediacetic Acid Ethyl Ester

Sign In for Pricing
View Details
Histone H3 Antibody
KC-3453-01 50 μL

Histone H3 Antibody

Sign In for Pricing
View Details
Histone H3 Antibody
KC-3453-02 100 µL

Histone H3 Antibody

Sign In for Pricing
View Details
Histone H3 Antibody
KC-3453-03 1 mL

Histone H3 Antibody

Sign In for Pricing
View Details
PRP19 (PRPF19) Rabbit Monoclonal Antibody
TA422627 100 µL

PRP19 (PRPF19) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
NDUFA13 Polyclonal Antibody
E-AB-15084-01 20 µL

NDUFA13 Polyclonal Antibody

Sign In for Pricing
View Details