Recombinant Human Myosin-binding protein C, slow-type (MYPC1), partial, Biotinylated
This Recombinant Human Myosin-binding protein C, slow-type (MYPC1), partial, Biotinylated spans the amino acid sequence from region 722-833. Purity: Greater than 85% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Myosin-binding protein C, slow-type; Slow MyBP-C; C-protein, skeletal muscle slow isoform; MYBPC1 MYBPCS
UniProt
Q00872
Expression Region
722-833
Origin
Homo sapiens (Human)
Field of Research
Musculoskeletal & Connective Tissue Research
Endotoxin
Not test
Purity
Greater than 85% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Storage Conditions
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
AA Sequence
TLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYCFEGSTSAKQSDENGEAAYDLPAEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQPILVKEI
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
KMP1935 100 µg
Biotinylated Recombinant Human CD79B Protein, Biotinylated
Sign In for Pricing
View Details 
MBS6379417-01 0.1 mL
GARS (Glycyl-tRNA Synthetase, Glycyl-tRNA Synthetase, Glycine-tRNA Ligase, GlyRS) (AP)
Sign In for Pricing
View Details MBS6379417-02 5x 0.1 mL
GARS (Glycyl-tRNA Synthetase, Glycyl-tRNA Synthetase, Glycine-tRNA Ligase, GlyRS) (AP)
Sign In for Pricing
View Details