Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Sodium channel protein type 7 subunit alpha (SCN7A), partial, Biotinylated

This Recombinant Human Sodium channel protein type 7 subunit alpha (SCN7A), partial, Biotinylated spans the amino acid sequence from region 260-338. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Sodium channel protein type 7 subunit alpha; Atypical sodium channel Nav2.1; Nax channel; Sodium channel protein type VII subunit alpha; SCN7A SCN6A

UniProt

Q01118

Expression Region

260-338

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MGNLKHKCFRWPQENENETLHNRTGNPYYIRETENFYYLEGERYALLCGNRTDAGQCPEGYVCVKAGINPDQGFTNFDS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Keratinocyte Growth Factor Aptamer
CTApt-064 10 nmol

Anti-Keratinocyte Growth Factor Aptamer

Sign In for Pricing
View Details
Kinesis CTC PM Kit - EACH
CHR6322 1 Each

Kinesis CTC PM Kit - EACH

Sign In for Pricing
View Details
Human OSBP shRNA Plasmid
abx953324-01 150 µg

Human OSBP shRNA Plasmid

Sign In for Pricing
View Details
Human OSBP shRNA Plasmid
abx953324-02 300 µg

Human OSBP shRNA Plasmid

Sign In for Pricing
View Details
Recombinant Rhesus Macaque FAM222A Protein, His (Fc)-Avi-tagged
FAM222A-1429R 50 µg

Recombinant Rhesus Macaque FAM222A Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details
UNKL Antibody
C41847-01 40 µL

UNKL Antibody

Sign In for Pricing
View Details