Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Testis-specific Y-encoded protein 1 (TSPY1), Biotinylated

This Recombinant Human Testis-specific Y-encoded protein 1 (TSPY1), Biotinylated spans the amino acid sequence from region 1-308. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Testis-specific Y-encoded protein 1; Cancer/testis antigen 78; CT78; TSPY1 TSPY

UniProt

Q01534

Expression Region

1-308

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MRPEGSLTYRVPERLRQGFCGVGRAAQALVCASAKEGTAFRMEAVQEGAAGVESEQAALGEEAVLLLDDIMAEVEVVAEEEGLVERREEAQRAQQAVPGPGPMTPESAPEELLAVQVELEPVNAQARKAFSRQREKMERRRKPHLDRRGAVIQSVPGFWANVIANHPQMSALITDEDEDMLSYMVSLEVGEEKHPVHLCKIMLFFRSNPYFQNKVITKEYLVNITEYRASHSTPIEWYPDYEVEAYRRRHHNSSLNFFNWFSDHNFAGSNKIAEILCKDLWRNPLQYYKRMKPPEEGTETSGDSQLLS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ReadiLink™ Rapid mFluor™ Blue 570 Antibody Labeling Kit *Microscale Optimized for Labeling 50 μg Antibody Per Reaction*
1120-AAT 2 Labelings

ReadiLink™ Rapid mFluor™ Blue 570 Antibody Labeling Kit *Microscale Optimized for Labeling 50 μg Antibody Per Reaction*

Sign In for Pricing
View Details
RRM2 Antibody
KC-36486-01 50 μL

RRM2 Antibody

Sign In for Pricing
View Details
RRM2 Antibody
KC-36486-02 100 µL

RRM2 Antibody

Sign In for Pricing
View Details
RRM2 Antibody
KC-36486-03 1 mL

RRM2 Antibody

Sign In for Pricing
View Details
Fmoc-D-Orn (Boc) TentaGel® S TRT Resin
SAD1220.25G 25 g

Fmoc-D-Orn (Boc) TentaGel® S TRT Resin

Sign In for Pricing
View Details
Human Complement Component 1, Q Subcomponent A (C1qA) ELISA Kit
RD-C1qA-Hu-01 96 Tests

Human Complement Component 1, Q Subcomponent A (C1qA) ELISA Kit

Sign In for Pricing
View Details