Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Interferon-induced transmembrane protein 3 (IFM3), partial, Biotinylated

This Recombinant Human Interferon-induced transmembrane protein 3 (IFM3), partial, Biotinylated spans the amino acid sequence from region 1-57. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Interferon-induced transmembrane protein 3; Dispanin subfamily A member 2b; DSPA2b; Interferon-inducible protein 1-8U; IFITM3

UniProt

Q01628

Expression Region

1-57

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MNHTVQTFFSPVNSGQPPNYEMLKEEHEVAVLGAPHNPAPPTSTVIHIRSETSVPDH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mono(2,3-dibromopropyl-d5) Phosphate Biscyclohexylamine Salt
TRC-M524627-2.5MG 2.5 mg

Mono(2,3-dibromopropyl-d5) Phosphate Biscyclohexylamine Salt

Sign In for Pricing
View Details
Recombinant BAdV-7 L3 Protein (aa 1-202)
VAng-Cr4083-500gEcoli 500 µg (E. coli)

Recombinant BAdV-7 L3 Protein (aa 1-202)

Sign In for Pricing
View Details
Mouse Spleen Tissue Snap Frozen
115001 500 mg

Mouse Spleen Tissue Snap Frozen

Sign In for Pricing
View Details
Recombinant Vitis vinifera Alpha-soluble NSF attachment protein
MBS1156851-01 0.02 mg (E-Coli)

Recombinant Vitis vinifera Alpha-soluble NSF attachment protein

Sign In for Pricing
View Details
Recombinant Vitis vinifera Alpha-soluble NSF attachment protein
MBS1156851-02 0.02 mg (Yeast)

Recombinant Vitis vinifera Alpha-soluble NSF attachment protein

Sign In for Pricing
View Details
Recombinant Vitis vinifera Alpha-soluble NSF attachment protein
MBS1156851-03 0.1 mg (E-Coli)

Recombinant Vitis vinifera Alpha-soluble NSF attachment protein

Sign In for Pricing
View Details