Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human OTU domain-containing protein 4 (OTUD4), partial, Biotinylated

This Recombinant Human OTU domain-containing protein 4 (OTUD4), partial, Biotinylated spans the amino acid sequence from region 34-155. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

OTU domain-containing protein 4; EC 3.4.19.12; HIV-1-induced protein HIN-1; OTUD4 HIN-1 KIAA1046

UniProt

Q01804

Expression Region

34-155

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

LYRKLVAKDGSCLFRAVAEQVLHSQSRHVEVRMACIHYLRENREKFEAFIEGSFEEYLKRLENPQEWVGQVEISALSLMYRKDFIIYREPNVSPSQVTENNFPEKVLLCFSNGNHYDIVYPI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LDL Receptor (LDLR) (NM_001195800) Human Over-expression Lysate
LC434377 20 µg

LDL Receptor (LDLR) (NM_001195800) Human Over-expression Lysate

Sign In for Pricing
View Details
p53 (TP53) Rabbit Polyclonal Antibody
AP02625PU-N 100 µL

p53 (TP53) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CD51 / Integrin V (ITGAV/1610), Biotin conjugate, 0.1mg/mL
BNCB1610-500 1x 500 µL

CD51 / Integrin V (ITGAV/1610), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
QuantiQuik™ L-Glutamate Quick Test Strips
QQGLUT10 10 Tests

QuantiQuik™ L-Glutamate Quick Test Strips

Sign In for Pricing
View Details
Recombinant Tlr2 Antibody
RC-4063-01 50 μL

Recombinant Tlr2 Antibody

Sign In for Pricing
View Details
Recombinant Tlr2 Antibody
RC-4063-02 100 µL

Recombinant Tlr2 Antibody

Sign In for Pricing
View Details