Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human OTU domain-containing protein 4 (OTUD4), partial, Biotinylated

This Recombinant Human OTU domain-containing protein 4 (OTUD4), partial, Biotinylated spans the amino acid sequence from region 34-155. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

OTU domain-containing protein 4; EC 3.4.19.12; HIV-1-induced protein HIN-1; OTUD4 HIN-1 KIAA1046

UniProt

Q01804

Expression Region

34-155

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

LYRKLVAKDGSCLFRAVAEQVLHSQSRHVEVRMACIHYLRENREKFEAFIEGSFEEYLKRLENPQEWVGQVEISALSLMYRKDFIIYREPNVSPSQVTENNFPEKVLLCFSNGNHYDIVYPI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

(E)-2-Thiopheneacrylic Acid
TRC-T344815-25G 25 g

(E)-2-Thiopheneacrylic Acid

Sign In for Pricing
View Details
Human CD80 Recombinant Rabbit monoclonal Antibody
HA723123 100 µL

Human CD80 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
IFluor® 790 goat anti-rabbit IgG (H+L)
16815-AAT 1 mg

IFluor® 790 goat anti-rabbit IgG (H+L)

Sign In for Pricing
View Details
PTPN6 Antibody
KC-2611-01 50 μL

PTPN6 Antibody

Sign In for Pricing
View Details
PTPN6 Antibody
KC-2611-02 100 µL

PTPN6 Antibody

Sign In for Pricing
View Details
PTPN6 Antibody
KC-2611-03 1 mL

PTPN6 Antibody

Sign In for Pricing
View Details