Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human OTU domain-containing protein 4 (OTUD4), partial, Biotinylated

This Recombinant Human OTU domain-containing protein 4 (OTUD4), partial, Biotinylated spans the amino acid sequence from region 34-155. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

OTU domain-containing protein 4; EC 3.4.19.12; HIV-1-induced protein HIN-1; OTUD4 HIN-1 KIAA1046

UniProt

Q01804

Expression Region

34-155

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

LYRKLVAKDGSCLFRAVAEQVLHSQSRHVEVRMACIHYLRENREKFEAFIEGSFEEYLKRLENPQEWVGQVEISALSLMYRKDFIIYREPNVSPSQVTENNFPEKVLLCFSNGNHYDIVYPI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DECR1 Protein Vector (Rat) (pPB-N-His)
PV263611 500 ng

DECR1 Protein Vector (Rat) (pPB-N-His)

Sign In for Pricing
View Details
Anti-Cathepsin E Antibody, Rabbit Polyclonal
MBS8111748-01 0.1 mL

Anti-Cathepsin E Antibody, Rabbit Polyclonal

Sign In for Pricing
View Details
Anti-Cathepsin E Antibody, Rabbit Polyclonal
MBS8111748-02 5x 0.1 mL

Anti-Cathepsin E Antibody, Rabbit Polyclonal

Sign In for Pricing
View Details
G-CSF Rabbit Monoclonal Antibody (Detector)
E56PA0690 100 µL

G-CSF Rabbit Monoclonal Antibody (Detector)

Sign In for Pricing
View Details
NFIA Rabbit Polyclonal Antibody (Biotin)
orb448431 100 µL

NFIA Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
TRNAR23 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)
LV753818 1.0 µg DNA

TRNAR23 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)

Sign In for Pricing
View Details