Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human RNA-binding protein EWS (EWS), Biotinylated

This Recombinant Human RNA-binding protein EWS (EWS), Biotinylated spans the amino acid sequence from region 1-656. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

RNA-binding protein EWS; EWS oncogene; Ewing sarcoma breakpoint region 1 protein; EWSR1 EWS

UniProt

Q01844

Expression Region

1-656

Origin

Homo sapiens (Human)

Field of Research

Cancer Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MASTDYSTYSQAAAQQGYSAYTAQPTQGYAQTTQAYGQQSYGTYGQPTDVSYTQAQTTATYGQTAYATSYGQPPTGYTTPTAPQAYSQPVQGYGTGAYDTTTATVTTTQASYAAQSAYGTQPAYPAYGQQPAATAPTRPQDGNKPTETSQPQSSTGGYNQPSLGYGQSNYSYPQVPGSYPMQPVTAPPSYPPTSYSSTQPTSYDQSSYSQQNTYGQPSSYGQQSSYGQQSSYGQQPPTSYPPQTGSYSQAPSQYSQQSSSYGQQSSFRQDHPSSMGVYGQESGGFSGPGENRSMSGPDNRGRGRGGFDRGGMSRGGRGGGRGGMGSAGERGGFNKPGGPMDEGPDLDLGPPVDPDEDSDNSAIYVQGLNDSVTLDDLADFFKQCGVVKMNKRTGQPMIHIYLDKETGKPKGDATVSYEDPPTAKAAVEWFDGKDFQGSKLKVSLARKKPPMNSMRGGLPPREGRGMPPPLRGGPGGPGGPGGPMGRMGGRGGDRGGFPPRGPRGSRGNPSGGGNVQHRAGDWQCPNPGCGNQNFAWRTECNQCKAPKPEGFLPPPFPPPGGDRGRGGPGGMRGGRGGLMDRGGPGGMFRGGRGGDRGGFRGGRGMDRGGFGGGRRGGPGGPPGPLMEQMGGRRGGRGGPGKMDKGEHRQERRDRPY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mpp1 Mouse Gene Knockout Kit (CRISPR)
KN510254 1 Kit

Mpp1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
ZNF643 Protein Vector (Human) (pPB-C-His)
PV048149 500 ng

ZNF643 Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
PNRC1 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-C-term-HA)
LV652370 1.0 µg DNA

PNRC1 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-C-term-HA)

Sign In for Pricing
View Details
CD41a (ITGA2B/1036), CF740 conjugate, 0.1mg/mL
BNC741036-500 1x 500 µL

CD41a (ITGA2B/1036), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fgr (NM_010208) Mouse Recombinant Protein
E45M45897M5 20 µg

Fgr (NM_010208) Mouse Recombinant Protein

Sign In for Pricing
View Details
USP14 (NM_005151) Human Tagged ORF Clone
RC200337 10 µg

USP14 (NM_005151) Human Tagged ORF Clone

Sign In for Pricing
View Details