Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Sodium-dependent dopamine transporter (SC6A3), partial, Biotinylated

This Recombinant Human Sodium-dependent dopamine transporter (SC6A3), partial, Biotinylated spans the amino acid sequence from region 172-236. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Sodium-dependent dopamine transporter; DA transporter; DAT; Solute carrier family 6 member 3; SLC6A3 DAT1

UniProt

Q01959

Expression Region

172-236

Origin

Homo sapiens (Human)

Field of Research

Pharmacology & Drug Discovery

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

TTELPWIHCNNSWNSPNCSDAHPGDSSGDSSGLNDTFGTTPAAEYFERGVLHLHQSHGIDDLGPP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD92 Lentiviral Activation Particles (h2)
sc-408392-LAC-2 200 µL

CD92 Lentiviral Activation Particles (h2)

Sign In for Pricing
View Details
Mouse Monoclonal Serum Amyloid A1/A2 Antibody (SAA/326) [DyLight 650]
NBP3-08412C 100 µL

Mouse Monoclonal Serum Amyloid A1/A2 Antibody (SAA/326) [DyLight 650]

Sign In for Pricing
View Details
MYLPF Polyclonal Antibody, AbBy Fluor™ 594 Conjugated
bs-5159R-BF594-01 20 µL

MYLPF Polyclonal Antibody, AbBy Fluor™ 594 Conjugated

Sign In for Pricing
View Details
MYLPF Polyclonal Antibody, AbBy Fluor™ 594 Conjugated
bs-5159R-BF594-02 100 µL

MYLPF Polyclonal Antibody, AbBy Fluor™ 594 Conjugated

Sign In for Pricing
View Details
Hebp2 Mouse siRNA Oligo Duplex (Locus ID 56016)
SR401667 1 Kit

Hebp2 Mouse siRNA Oligo Duplex (Locus ID 56016)

Sign In for Pricing
View Details
Rabbit anti-human protein tyrosine phosphatase, non-receptor type 1 polyclonal Antibody
MBS710770-01 0.1 mL

Rabbit anti-human protein tyrosine phosphatase, non-receptor type 1 polyclonal Antibody

Sign In for Pricing
View Details