Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Sodium-dependent dopamine transporter (SC6A3), partial, Biotinylated

This Recombinant Human Sodium-dependent dopamine transporter (SC6A3), partial, Biotinylated spans the amino acid sequence from region 172-236. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Sodium-dependent dopamine transporter; DA transporter; DAT; Solute carrier family 6 member 3; SLC6A3 DAT1

UniProt

Q01959

Expression Region

172-236

Origin

Homo sapiens (Human)

Field of Research

Pharmacology & Drug Discovery

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

TTELPWIHCNNSWNSPNCSDAHPGDSSGDSSGLNDTFGTTPAAEYFERGVLHLHQSHGIDDLGPP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human TNF related activation induced cytokine, TRANCE ELISA Kit
YLA0456HU-01 48 Tests

Human TNF related activation induced cytokine, TRANCE ELISA Kit

Sign In for Pricing
View Details
Human TNF related activation induced cytokine, TRANCE ELISA Kit
YLA0456HU-02 96 Tests

Human TNF related activation induced cytokine, TRANCE ELISA Kit

Sign In for Pricing
View Details
A-966492
C16694-10mg 10 mg

A-966492

Sign In for Pricing
View Details
Ptchd2 ORF Vector (Mouse) (pORF)
ORF055152 1.0 µg DNA

Ptchd2 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
Recombinant Saccharomyces cerevisiae Uncharacterized protein YHL050C (YHL050C) , partial
MBS1114873-01 1 mg (E-Coli)

Recombinant Saccharomyces cerevisiae Uncharacterized protein YHL050C (YHL050C) , partial

Sign In for Pricing
View Details
Recombinant Saccharomyces cerevisiae Uncharacterized protein YHL050C (YHL050C) , partial
MBS1114873-02 1 mg (Yeast)

Recombinant Saccharomyces cerevisiae Uncharacterized protein YHL050C (YHL050C) , partial

Sign In for Pricing
View Details