Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Sodium-dependent dopamine transporter (SC6A3), partial, Biotinylated

This Recombinant Human Sodium-dependent dopamine transporter (SC6A3), partial, Biotinylated spans the amino acid sequence from region 172-236. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Sodium-dependent dopamine transporter; DA transporter; DAT; Solute carrier family 6 member 3; SLC6A3 DAT1

UniProt

Q01959

Expression Region

172-236

Origin

Homo sapiens (Human)

Field of Research

Pharmacology & Drug Discovery

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

TTELPWIHCNNSWNSPNCSDAHPGDSSGDSSGLNDTFGTTPAAEYFERGVLHLHQSHGIDDLGPP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse FAM57A siRNA
abx916350-01 15 nmol

Mouse FAM57A siRNA

Sign In for Pricing
View Details
Mouse FAM57A siRNA
abx916350-02 30 nmol

Mouse FAM57A siRNA

Sign In for Pricing
View Details
Rabbit Monoclonal HABP1/C1QBP/GC1q R Antibody (106) [PerCP]
NBP2-90476PCP 0.1 mL

Rabbit Monoclonal HABP1/C1QBP/GC1q R Antibody (106) [PerCP]

Sign In for Pricing
View Details
Rat CT1 (Cardiotrophin 1) ELISA Kit
ER21511 96 Tests

Rat CT1 (Cardiotrophin 1) ELISA Kit

Sign In for Pricing
View Details
mmu-miR-7651-3p miRNA Mimic
MBS8302388-01 5 nmol

mmu-miR-7651-3p miRNA Mimic

Sign In for Pricing
View Details
mmu-miR-7651-3p miRNA Mimic
MBS8302388-02 10 nmol

mmu-miR-7651-3p miRNA Mimic

Sign In for Pricing
View Details