Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Contactin-2 (CNTN2), partial, Biotinylated

This Recombinant Human Contactin-2 (CNTN2), partial, Biotinylated spans the amino acid sequence from region 610-708. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Contactin-2; Axonal glycoprotein TAG-1; Axonin-1; Transient axonal glycoprotein 1; TAX-1; CNTN2 AXT TAG1 TAX1

UniProt

Q02246

Expression Region

610-708

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

PPGGVVVRDIGDTTIQLSWSRGFDNHSPIAKYTLQARTPPAGKWKQVRTNPANIEGNAETAQVLGLTPWMDYEFRVIASNILGTGEPSGPSSKIRTREA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal FRMPD2 Antibody [DyLight 594]
NBP1-77083DL594 0.1 mL

Rabbit Polyclonal FRMPD2 Antibody [DyLight 594]

Sign In for Pricing
View Details
Myoglobin Recombinant Antibody, Biotin Conjugated
bsm-41107R-Biotin 100 µL

Myoglobin Recombinant Antibody, Biotin Conjugated

Sign In for Pricing
View Details
pEGFP-HRH3 Plasmid
PVT10350 2 µg

pEGFP-HRH3 Plasmid

Sign In for Pricing
View Details
PRC1 (Phospho-Thr470) Polyclonal Conjugated Antibody
orb1630027 100 µL

PRC1 (Phospho-Thr470) Polyclonal Conjugated Antibody

Sign In for Pricing
View Details
Abiprubart (Reference antibody)
E55B1341 100 µg

Abiprubart (Reference antibody)

Sign In for Pricing
View Details
Mouse Monoclonal VSIG4 Antibody (528903) [FITC]
FAB4646F 0.1 mL

Mouse Monoclonal VSIG4 Antibody (528903) [FITC]

Sign In for Pricing
View Details