Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Interferon regulatory factor 8 (IRF8), Biotinylated

This Recombinant Human Interferon regulatory factor 8 (IRF8), Biotinylated spans the amino acid sequence from region 1-426. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Interferon regulatory factor 8; IRF-8; Interferon consensus sequence-binding protein; H-ICSBP; ICSBP; IRF8 ICSBP1

UniProt

Q02556

Expression Region

1-426

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation; Cell Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MCDRNGGRRLRQWLIEQIDSSMYPGLIWENEEKSMFRIPWKHAGKQDYNQEVDASIFKAWAVFKGKFKEGDKAEPATWKTRLRCALNKSPDFEEVTDRSQLDISEPYKVYRIVPEEEQKCKLGVATAGCVNEVTEMECGRSEIDELIKEPSVDDYMGMIKRSPSPPEACRSQLLPDWWAQQPSTGVPLVTGYTTYDAHHSAFSQMVISFYYGGKLVGQATTTCPEGCRLSLSQPGLPGTKLYGPEGLELVRFPPADAIPSERQRQVTRKLFGHLERGVLLHSSRQGVFVKRLCQGRVFCSGNAVVCKGRPNKLERDEVVQVFDTSQFFRELQQFYNSQGRLPDGRVVLCFGEEFPDMAPLRSKLILVQIEQLYVRQLAEEAGKSCGAGSVMQAPEEPPPDQVFRMFPDICASHQRSFFRENQQITV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phosphatase Buffer 5X
41620003-1 100 mL

Phosphatase Buffer 5X

Sign In for Pricing
View Details
Ran Rabbit mAb
56233 50 µL

Ran Rabbit mAb

Sign In for Pricing
View Details
CAND1 Protein Vector (Human) (pPB-C-His)
PV067341 500 ng

CAND1 Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
MAb to hCG beta
MBS311627-01 1 mg

MAb to hCG beta

Sign In for Pricing
View Details
MAb to hCG beta
MBS311627-02 5x 1 mg

MAb to hCG beta

Sign In for Pricing
View Details
SLBP (m) -PR
sc-38322-PR 10 µM - 20 µL

SLBP (m) -PR

Sign In for Pricing
View Details