Recombinant Human 6-pyruvoyl tetrahydrobiopterin synthase (PTPS), Biotinylated
This Recombinant Human 6-pyruvoyl tetrahydrobiopterin synthase (PTPS), Biotinylated spans the amino acid sequence from region 1-145. Purity: Greater than 85% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
6-pyruvoyl tetrahydrobiopterin synthase; PTP synthase; PTPS; EC 4.2.3.12; PTS
UniProt
Q03393
Expression Region
1-145
Origin
Homo sapiens (Human)
Field of Research
Metabolism Research
Endotoxin
Not test
Purity
Greater than 85% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Storage Conditions
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
AA Sequence
MSTEGGGRRCQAQVSRRISFSASHRLYSKFLSDEENLKLFGKCNNPNGHGHNYKVVVTVHGEIDPATGMVMNLADLKKYMEEAIMQPLDHKNLDMDVPYFADVVSTTENVAVYIWDNLQKVLPVGVLYKVKVYETDNNIVVYKGE
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
302883-ML650 100 µL
ZRSR2 (U2 Small Nuclear Ribonucleoprotein Auxiliary Factor 35kD Subunit-Related Protein 2, CCCH Type Zinc Finger, RNA-Binding Motif and Serine/Arginine rich Protein 2, Renal Carcinoma antigen NY-REN-20, U2 (RNU2) Small Nuclear RNA Auxiliary Factor 1-like 2, U2AF35-Related Protein, URP, ZRSR2, U2AF1-RS2, U2AF1L2, U2AF1RS2, URP) (MaxLight 650) discontinued
Sign In for Pricing
View Details 
