Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Collagen alpha-1 (X) chain (COAA1), Biotinylated

This Recombinant Human Collagen alpha-1 (X) chain (COAA1), Biotinylated spans the amino acid sequence from region 19-680. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Collagen alpha-1 (X; chain COL10A1

UniProt

Q03692

Expression Region

19-680

Origin

Homo sapiens (Human)

Field of Research

Musculoskeletal & Connective Tissue Research

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

VFYAERYQMPTGIKGPLPNTKTQFFIPYTIKSKGIAVRGEQGTPGPPGPAGPRGHPGPSGPPGKPGYGSPGLQGEPGLPGPPGPSAVGKPGVPGLPGKPGERGPYGPKGDVGPAGLPGPRGPPGPPGIPGPAGISVPGKPGQQGPTGAPGPRGFPGEKGAPGVPGMNGQKGEMGYGAPGRPGERGLPGPQGPTGPSGPPGVGKRGENGVPGQPGIKGDRGFPGEMGPIGPPGPQGPPGERGPEGIGKPGAAGAPGQPGIPGTKGLPGAPGIAGPPGPPGFGKPGLPGLKGERGPAGLPGGPGAKGEQGPAGLPGKPGLTGPPGNMGPQGPKGIPGSHGLPGPKGETGPAGPAGYPGAKGERGSPGSDGKPGYPGKPGLDGPKGNPGLPGPKGDPGVGGPPGLPGPVGPAGAKGMPGHNGEAGPRGAPGIPGTRGPIGPPGIPGFPGSKGDPGSPGPPGPAGIATKGLNGPTGPPGPPGPRGHSGEPGLPGPPGPPGPPGQAVMPEGFIKAGQRPSLSGTPLVSANQGVTGMPVSAFTVILSKAYPAIGTPIPFDKILYNRQQHYDPRTGIFTCQIPGIYYFSYHVHVKGTHVWVGLYKNGTPVMYTYDEYTKGYLDQASGSAIIDLTENDQVWLQLPNAESNGLYSSEYVHSSFSGFLVAPM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Syncrip shRNA (UAS) - Lentiviral mouse Syncrip shRNA (UAS) plasmid
GTR15284287 1 Vial

Lentiviral mouse Syncrip shRNA (UAS) - Lentiviral mouse Syncrip shRNA (UAS) plasmid

Sign In for Pricing
View Details
SULF2 3'UTR Luciferase Stable Cell Line
TU024908 1.0 mL

SULF2 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Rat Glucagon Like Peptide 1 Receptor (GLP1R) ELISA Kit
EKN50278 96 Tests

Rat Glucagon Like Peptide 1 Receptor (GLP1R) ELISA Kit

Sign In for Pricing
View Details
Angelicae Pubescentis Radix Extract
E3169-5mg 5 mg

Angelicae Pubescentis Radix Extract

Sign In for Pricing
View Details
Androgen Receptor (Biotin)
545041 200 µL

Androgen Receptor (Biotin)

Sign In for Pricing
View Details
Recombinant Shigella sonnei Hydroxylamine reductase (hcp), partial
MBS1369204 Inquire

Recombinant Shigella sonnei Hydroxylamine reductase (hcp), partial

Sign In for Pricing
View Details