Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BMP-3B/GDF10, Human (His)

Bone morphogenetic protein 3 (BMP-3; GDF10) is a polymorphic ligand protein belonging to the TGF-β family. BMP-3 is the main component of osteoblast and has osteogenic activity[1]. BMP-3 plays an inhibitory role in the carcinogenic process, and inhibits the occurrence of colon tumors through ActRIIB/ SMad2-dependent and TAK1/JNK signaling pathways[2]. BMP-3B/GDF10 Protein, Human has a total length of 110 amino acids (Q369-R478), is expressed in E. coli cells.

Product Specifications

Product Name Alternative

BMP-3B/GDF10 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Applications

Neuroscience-Neuromodulation

Assay Protocol

https://www.medchemexpress.com/cytokines/bmp-3b-gdf10-protein-human.html

Purity

95.00

Smiles

MQWDEPRVCSRRYLKVDFADIGWNEWIISPKSFDAYYCAGACEFPMPKIVRPSNHATIQSIVRAVGIIPGIPEPCCVPDKMNSLGVLFLDENRNVVLKVYPNMSVDTCACR

Molecular Formula

2662 (Gene_ID) P55107 (Q369-R478) (Accession)

Molecular Weight

Approximately 16 kDa

References & Citations

[1]Yang P, et al. The role of bone morphogenetic protein signaling in vascular calcification. Bone. 2020 Dec;141:115542.|[2]Miyazawa K, et al. Regulation of TGF-β Family Signaling by Inhibitory Smads. Cold Spring Harb Perspect Biol. 2017 Mar 1;9 (3) :a022095.|[3]Wen J, et al. BMP3 suppresses colon tumorigenesis via ActRIIB/SMAD2-dependent and TAK1/JNK signaling pathways. J Exp Clin Cancer Res. 2019 Oct 28;38 (1) :428.|[4]Bahamonde ME, et al. BMP3: to be or not to be a BMP. J Bone Joint Surg Am. 2001;83-A Suppl 1 (Pt 1) :S56-62.|[5]Stewart A, et al. BMP-3 promotes mesenchymal stem cell proliferation through the TGF-beta/activin signaling pathway. J Cell Physiol. 2010 Jun;223 (3) :658-66.|[6]Zhou X, et al. BMP3 Alone and Together with TGF-β Promote the Differentiation of Human Mesenchymal Stem Cells into a Nucleus Pulposus-Like Phenotype. Int J Mol Sci. 2015 Aug 27;16 (9) :20344-59. |[7]Faucheux C, et al. Opposing actions of BMP3 and TGFβ1 in human bone marrow stromal cell growth and differentiation[J]. Biochemical and biophysical research communications, 1997, 241 (3) : 787-793.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2,2'-Sulfinyldiethanol
TRC-S733510-250MG 250 mg

2,2'-Sulfinyldiethanol

Sign In for Pricing
View Details
Ralb Mouse Gene Knockout Kit (CRISPR)
KN514440 1 Kit

Ralb Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Nitrazepam-d5
TRC-N490142-1MG 1 mg

Nitrazepam-d5

Sign In for Pricing
View Details
HLA Class II DQ Mouse Monoclonal Antibody [Clone ID: FN81]
AM05947BT-N 100 µg

HLA Class II DQ Mouse Monoclonal Antibody [Clone ID: FN81]

Sign In for Pricing
View Details
RBFOX1 (N-term) Mouse Monoclonal Antibody [Clone ID: 1G10]
AM32992PU-N 100 µL

RBFOX1 (N-term) Mouse Monoclonal Antibody [Clone ID: 1G10]

Sign In for Pricing
View Details
PI 3 Kinase p85 beta (PIK3R2) (N-term) Rabbit Polyclonal Antibody
AP14949PU-N 400 µL

PI 3 Kinase p85 beta (PIK3R2) (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details