Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BMP-3B/GDF10, Human (His)

Bone morphogenetic protein 3 (BMP-3; GDF10) is a polymorphic ligand protein belonging to the TGF-β family. BMP-3 is the main component of osteoblast and has osteogenic activity[1]. BMP-3 plays an inhibitory role in the carcinogenic process, and inhibits the occurrence of colon tumors through ActRIIB/ SMad2-dependent and TAK1/JNK signaling pathways[2]. BMP-3B/GDF10 Protein, Human has a total length of 110 amino acids (Q369-R478), is expressed in E. coli cells.

Product Specifications

Product Name Alternative

BMP-3B/GDF10 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Applications

Neuroscience-Neuromodulation

Assay Protocol

https://www.medchemexpress.com/cytokines/bmp-3b-gdf10-protein-human.html

Purity

95.00

Smiles

MQWDEPRVCSRRYLKVDFADIGWNEWIISPKSFDAYYCAGACEFPMPKIVRPSNHATIQSIVRAVGIIPGIPEPCCVPDKMNSLGVLFLDENRNVVLKVYPNMSVDTCACR

Molecular Formula

2662 (Gene_ID) P55107 (Q369-R478) (Accession)

Molecular Weight

Approximately 16 kDa

References & Citations

[1]Yang P, et al. The role of bone morphogenetic protein signaling in vascular calcification. Bone. 2020 Dec;141:115542.|[2]Miyazawa K, et al. Regulation of TGF-β Family Signaling by Inhibitory Smads. Cold Spring Harb Perspect Biol. 2017 Mar 1;9 (3) :a022095.|[3]Wen J, et al. BMP3 suppresses colon tumorigenesis via ActRIIB/SMAD2-dependent and TAK1/JNK signaling pathways. J Exp Clin Cancer Res. 2019 Oct 28;38 (1) :428.|[4]Bahamonde ME, et al. BMP3: to be or not to be a BMP. J Bone Joint Surg Am. 2001;83-A Suppl 1 (Pt 1) :S56-62.|[5]Stewart A, et al. BMP-3 promotes mesenchymal stem cell proliferation through the TGF-beta/activin signaling pathway. J Cell Physiol. 2010 Jun;223 (3) :658-66.|[6]Zhou X, et al. BMP3 Alone and Together with TGF-β Promote the Differentiation of Human Mesenchymal Stem Cells into a Nucleus Pulposus-Like Phenotype. Int J Mol Sci. 2015 Aug 27;16 (9) :20344-59. |[7]Faucheux C, et al. Opposing actions of BMP3 and TGFβ1 in human bone marrow stromal cell growth and differentiation[J]. Biochemical and biophysical research communications, 1997, 241 (3) : 787-793.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue Total RNA, Ovary: left
CR560364 5 µg

Tissue Total RNA, Ovary: left

Sign In for Pricing
View Details
CD200 (NM_005944) Human Recombinant Protein
TP306356M 100 µg

CD200 (NM_005944) Human Recombinant Protein

Sign In for Pricing
View Details
Human PLEKHN1 activation kit by CRISPRa
GA113353 1 Kit

Human PLEKHN1 activation kit by CRISPRa

Sign In for Pricing
View Details
Dolutegravir Sodium Salt
TRC-D528805-50MG 50 mg

Dolutegravir Sodium Salt

Sign In for Pricing
View Details
OLFM4 Recombinant Rabbit monoclonal Antibody
HA750714 100 µL

OLFM4 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Ataxin 3 (ATXN3) Rabbit Polyclonal Antibody
TA365498 100 µL

Ataxin 3 (ATXN3) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details