Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BMP-3B/GDF10, Human (His)

Bone morphogenetic protein 3 (BMP-3; GDF10) is a polymorphic ligand protein belonging to the TGF-β family. BMP-3 is the main component of osteoblast and has osteogenic activity[1]. BMP-3 plays an inhibitory role in the carcinogenic process, and inhibits the occurrence of colon tumors through ActRIIB/ SMad2-dependent and TAK1/JNK signaling pathways[2]. BMP-3B/GDF10 Protein, Human has a total length of 110 amino acids (Q369-R478), is expressed in E. coli cells.

Product Specifications

Product Name Alternative

BMP-3B/GDF10 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Applications

Neuroscience-Neuromodulation

Assay Protocol

https://www.medchemexpress.com/cytokines/bmp-3b-gdf10-protein-human.html

Purity

95.00

Smiles

MQWDEPRVCSRRYLKVDFADIGWNEWIISPKSFDAYYCAGACEFPMPKIVRPSNHATIQSIVRAVGIIPGIPEPCCVPDKMNSLGVLFLDENRNVVLKVYPNMSVDTCACR

Molecular Formula

2662 (Gene_ID) P55107 (Q369-R478) (Accession)

Molecular Weight

Approximately 16 kDa

References & Citations

[1]Yang P, et al. The role of bone morphogenetic protein signaling in vascular calcification. Bone. 2020 Dec;141:115542.|[2]Miyazawa K, et al. Regulation of TGF-β Family Signaling by Inhibitory Smads. Cold Spring Harb Perspect Biol. 2017 Mar 1;9 (3) :a022095.|[3]Wen J, et al. BMP3 suppresses colon tumorigenesis via ActRIIB/SMAD2-dependent and TAK1/JNK signaling pathways. J Exp Clin Cancer Res. 2019 Oct 28;38 (1) :428.|[4]Bahamonde ME, et al. BMP3: to be or not to be a BMP. J Bone Joint Surg Am. 2001;83-A Suppl 1 (Pt 1) :S56-62.|[5]Stewart A, et al. BMP-3 promotes mesenchymal stem cell proliferation through the TGF-beta/activin signaling pathway. J Cell Physiol. 2010 Jun;223 (3) :658-66.|[6]Zhou X, et al. BMP3 Alone and Together with TGF-β Promote the Differentiation of Human Mesenchymal Stem Cells into a Nucleus Pulposus-Like Phenotype. Int J Mol Sci. 2015 Aug 27;16 (9) :20344-59. |[7]Faucheux C, et al. Opposing actions of BMP3 and TGFβ1 in human bone marrow stromal cell growth and differentiation[J]. Biochemical and biophysical research communications, 1997, 241 (3) : 787-793.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

pCR4-TOPO-KRTCAP3 Plasmid
PVT18022 2 µg

pCR4-TOPO-KRTCAP3 Plasmid

Sign In for Pricing
View Details
Recombinant Laribacter hongkongensis Homoserine O-acetyltransferase (metX)
MBS1052275-01 0.02 mg (E-Coli)

Recombinant Laribacter hongkongensis Homoserine O-acetyltransferase (metX)

Sign In for Pricing
View Details
Recombinant Laribacter hongkongensis Homoserine O-acetyltransferase (metX)
MBS1052275-02 0.02 mg (Yeast)

Recombinant Laribacter hongkongensis Homoserine O-acetyltransferase (metX)

Sign In for Pricing
View Details
Recombinant Laribacter hongkongensis Homoserine O-acetyltransferase (metX)
MBS1052275-03 0.1 mg (E-Coli)

Recombinant Laribacter hongkongensis Homoserine O-acetyltransferase (metX)

Sign In for Pricing
View Details
Recombinant Laribacter hongkongensis Homoserine O-acetyltransferase (metX)
MBS1052275-04 0.1 mg (Yeast)

Recombinant Laribacter hongkongensis Homoserine O-acetyltransferase (metX)

Sign In for Pricing
View Details
Recombinant Laribacter hongkongensis Homoserine O-acetyltransferase (metX)
MBS1052275-05 0.02 mg (Baculovirus)

Recombinant Laribacter hongkongensis Homoserine O-acetyltransferase (metX)

Sign In for Pricing
View Details