Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Copper-transporting ATPase 1 (ATP7A), partial, Biotinylated

This Recombinant Human Copper-transporting ATPase 1 (ATP7A), partial, Biotinylated spans the amino acid sequence from region 676-714. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Copper-transporting ATPase 1; EC 7.2.2.8; Copper pump 1; Menkes disease-associated protein; ATP7A MC1 MNK

UniProt

Q04656

Expression Region

676-714

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

HHFATLHHNQNMSKEEMINLHSSMFLERQILPGLSVMNL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Angiogenin Recombinant Rabbit monoclonal Antibody
HA725078B 100 µL

Human Angiogenin Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
CDC25A (Ab-178) Antibody
8B8017-AAT 50 µg

CDC25A (Ab-178) Antibody

Sign In for Pricing
View Details
Ptp4a1 (BC094447) Mouse Tagged ORF Clone
MG201483 10 µg

Ptp4a1 (BC094447) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Macrophage Inflammatory Protein 3 beta (CCL19) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI6A3]
TA804342AM 100 µL

Macrophage Inflammatory Protein 3 beta (CCL19) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI6A3]

Sign In for Pricing
View Details
Cytochrome P450 2E1 (CYP2E1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI9E6]
TA500735AM 100 µL

Cytochrome P450 2E1 (CYP2E1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI9E6]

Sign In for Pricing
View Details
Carboxy Polystyrene
H25031508.25G 25 g

Carboxy Polystyrene

Sign In for Pricing
View Details