Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Copper-transporting ATPase 1 (ATP7A), partial, Biotinylated

This Recombinant Human Copper-transporting ATPase 1 (ATP7A), partial, Biotinylated spans the amino acid sequence from region 676-714. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Copper-transporting ATPase 1; EC 7.2.2.8; Copper pump 1; Menkes disease-associated protein; ATP7A MC1 MNK

UniProt

Q04656

Expression Region

676-714

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

HHFATLHHNQNMSKEEMINLHSSMFLERQILPGLSVMNL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MED10 Human Gene Knockout Kit (CRISPR)
KN401665 1 Kit

MED10 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Mouse Timm44 activation kit by CRISPRa
GA204354 1 Kit

Mouse Timm44 activation kit by CRISPRa

Sign In for Pricing
View Details
CD80 (B7-1) (C80/2723), CF405S conjugate, 0.1mg/mL
BNC042723-100 1x 100 µL

CD80 (B7-1) (C80/2723), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
DLK-1 Recombinant Rabbit monoclonal Antibody
HA750970 100 µL

DLK-1 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
n-Butyraldehyde-2,2,3,3,4,4,4-d7
TRC-B689899-5MG 5 mg

n-Butyraldehyde-2,2,3,3,4,4,4-d7

Sign In for Pricing
View Details
PSMA7 Human Gene Knockout Kit (CRISPR)
KN401169 1 Kit

PSMA7 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details