Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human P protein (P), partial, Biotinylated

This Recombinant Human P protein (P), partial, Biotinylated spans the amino acid sequence from region 198-330. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

P protein; Melanocyte-specific transporter protein; Pink-eyed dilution protein homolog; OCA2 D15S12 P

UniProt

Q04671

Expression Region

198-330

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

PDQGKLWQLLALSPLENYSVNLSSHVDSTLLQVDLAGALVASGPSRPGREEHIVVELTQADALGSRWRRPQQVTHNWTVYLNPRRSEHSVMSRTFEVLTRETVSISIRASLQQTQAVPLLMAHQYLRGSVETQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sub1 3'UTR GFP Stable Cell Line
TU271378 1.0 mL

Sub1 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
RasGEF Domain Family Member 1A (RASGEF1A) Antibody
abx237129 100 µg

RasGEF Domain Family Member 1A (RASGEF1A) Antibody

Sign In for Pricing
View Details
Canine F box only protein 22 (FBXO22) ELISA kit
GTR10424062 96 Well

Canine F box only protein 22 (FBXO22) ELISA kit

Sign In for Pricing
View Details
Cxxc5 sgRNA CRISPR Lentivector (Rat) (Target 1)
K7577602 1.0 µg DNA

Cxxc5 sgRNA CRISPR Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details
Human ADAM33 ELISA Kit
ELA-E1590h 96 Tests

Human ADAM33 ELISA Kit

Sign In for Pricing
View Details
LMAN2 Protein Vector (Human) (pPM-C-His)
PV023820 500 ng

LMAN2 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details