Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Activin receptor type-1 (ACVR1), partial, Biotinylated

This Recombinant Human Activin receptor type-1 (ACVR1), partial, Biotinylated spans the amino acid sequence from region 21-123. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Activin receptor type-1; EC 2.7.11.30; Activin receptor type I; ACTR-I; Activin receptor-like kinase 2; ALK-2; Serine/threonine-protein kinase receptor R1; SKR1; TGF-B superfamily receptor type I; TSR-I; ACVR1 ACVRLK2

UniProt

Q04771

Expression Region

21-123

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MEDEKPKVNPKLYMCVCEGLSCGNEDHCEGQQCFSSLSINDGFHVYQKGCFQVYEQGKMTCKTPPSPGQAVECCQGDWCNRNITAQLPTKGKSFPGTQNFHLE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

STK36 (Serine/Threonine-protein Kinase 36, Fused Homolog, KIAA1278) (MaxLight 550)
MBS6395418-01 0.1 mL

STK36 (Serine/Threonine-protein Kinase 36, Fused Homolog, KIAA1278) (MaxLight 550)

Sign In for Pricing
View Details
STK36 (Serine/Threonine-protein Kinase 36, Fused Homolog, KIAA1278) (MaxLight 550)
MBS6395418-02 5x 0.1 mL

STK36 (Serine/Threonine-protein Kinase 36, Fused Homolog, KIAA1278) (MaxLight 550)

Sign In for Pricing
View Details
Cnp sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
K4723905 3x 1.0 µg

Cnp sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
Rat Monoclonal Pax5/BSAP Antibody (1H9) [Alexa Fluor 532]
NBP2-00258AF532 0.1 mL

Rat Monoclonal Pax5/BSAP Antibody (1H9) [Alexa Fluor 532]

Sign In for Pricing
View Details
6- (3,4-Dichloro-benzyl) -3-thioxo-3,4-dihydro-2H-[1,2,4]triazin-5-one
sc-352939 1 g

6- (3,4-Dichloro-benzyl) -3-thioxo-3,4-dihydro-2H-[1,2,4]triazin-5-one

Sign In for Pricing
View Details
Ngn3 (Neurogenin3) (6N1) Mouse Monoclonal antibody
E28PE4358 100 µL

Ngn3 (Neurogenin3) (6N1) Mouse Monoclonal antibody

Sign In for Pricing
View Details