Recombinant Human Sialomucin core protein 24 (MUC24), partial, Biotinylated
This Recombinant Human Sialomucin core protein 24 (MUC24), partial, Biotinylated spans the amino acid sequence from region 24-162. Purity: Greater than 85% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Sialomucin core protein 24; MUC-24; Endolyn; Multi-glycosylated core protein 24; MGC-24; MGC-24v; CD antigen CD164; CD164
UniProt
Q04900
Expression Region
24-162
Origin
Homo sapiens (Human)
Endotoxin
Not test
Purity
Greater than 85% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Storage Conditions
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
AA Sequence
DKNTTQHPNVTTLAPISNVTSAPVTSLPLVTTPAPETCEGRNSCVSCFNVSVVNTTCFWIECKDESYCSHNSTVSDCQVGNTTDFCSVSTATPVPTANSTAKPTVQPSPSTTSKTVTTSGTTNNTVTPTSQPVRKSTFD
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
orb502537 100 µL
Phospho-Dab1 (Tyr198) Rabbit Polyclonal Antibody (Biotin)
Sign In for Pricing
View Details 
S7965-25H-ML650 100 µL
Staphylococcus aureus, Enterotoxin B (Enterotoxin Type B, SEB, entB) (MaxLight 650) discontinued
Sign In for Pricing
View Details 
MBS1417010-01 0.02 mg (E-Coli)
Recombinant Pseudomonas putida Uracil-DNA glycosylase (ung)
Sign In for Pricing
View Details MBS1417010-02 0.1 mg (E-Coli)
Recombinant Pseudomonas putida Uracil-DNA glycosylase (ung)
Sign In for Pricing
View Details MBS1417010-03 0.02 mg (Yeast)
Recombinant Pseudomonas putida Uracil-DNA glycosylase (ung)
Sign In for Pricing
View Details