Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Ubiquitin-protein ligase E3A (UBE3A), partial, Biotinylated

This Recombinant Human Ubiquitin-protein ligase E3A (UBE3A), partial, Biotinylated spans the amino acid sequence from region 776-875. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Ubiquitin-protein ligase E3A; EC 2.3.2.26; E6AP ubiquitin-protein ligase; HECT-type ubiquitin transferase E3A; Human papillomavirus E6-associated protein; Oncogenic protein-associated protein E6-AP; Renal carcinoma antigen NY-REN-54; UBE3A E6AP EPVE6AP HPVE6A

UniProt

Q05086

Expression Region

776-875

Origin

Homo sapiens (Human)

Field of Research

Molecular Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

YDGGYTRDSVLIREFWEIVHSFTDEQKRLFLQFTTGTDRAPVGGLGKLKMIIAKNGPDTERLPTSHTCFNVLLLPEYSSKEKLKERLLKAITYAKGFGML

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Clostridium Botulinum rpmC Protein (aa 1-70) (strain Eklund 17B / Type B)
VAng-Lsx8623-1mgEcoli 1 mg (E. coli)

Recombinant Clostridium Botulinum rpmC Protein (aa 1-70) (strain Eklund 17B / Type B)

Sign In for Pricing
View Details
Mouse CCR5 Affinity Purified Polyclonal Ab
AF6138 100 µg

Mouse CCR5 Affinity Purified Polyclonal Ab

Sign In for Pricing
View Details
rno-miR-9b-3p miRNA Inhibitor
MIR01869 2x 5.0 nmol

rno-miR-9b-3p miRNA Inhibitor

Sign In for Pricing
View Details
*Carbenicillin Solution 100mg/ml w/ 100mg/ml carbenicillin in sterile tissue culture grade water
A01019-01 20 mL

*Carbenicillin Solution 100mg/ml w/ 100mg/ml carbenicillin in sterile tissue culture grade water

Sign In for Pricing
View Details
*Carbenicillin Solution 100mg/ml w/ 100mg/ml carbenicillin in sterile tissue culture grade water
A01019-02 5x 20 mL

*Carbenicillin Solution 100mg/ml w/ 100mg/ml carbenicillin in sterile tissue culture grade water

Sign In for Pricing
View Details
Mouse Eif4ebp2 (NM_010124) AAV Particle
MR200578A1V 250 µL

Mouse Eif4ebp2 (NM_010124) AAV Particle

Sign In for Pricing
View Details