Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Focal adhesion kinase 1 (FAK1), partial, Biotinylated

This Recombinant Human Focal adhesion kinase 1 (FAK1), partial, Biotinylated spans the amino acid sequence from region 35-355. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Focal adhesion kinase 1; FADK 1; EC 2.7.10.2; Focal adhesion kinase-related nonkinase; FRNK; Protein phosphatase 1 regulatory subunit 71; PPP1R71; Protein-tyrosine kinase 2; p125FAK; pp125FAK; PTK2 FAK FAK1

UniProt

Q05397

Expression Region

35-355

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

RVLKVFHYFESNSEPTTWASIIRHGDATDVRGIIQKIVDSHKVKHVACYGFRLSHLRSEEVHWLHVDMGVSSVREKYELAHPPEEWKYELRIRYLPKGFLNQFTEDKPTLNFFYQQVKSDYMLEIADQVDQEIALKLGCLEIRRSYWEMRGNALEKKSNYEVLEKDVGLKRFFPKSLLDSVKAKTLRKLIQQTFRQFANLNREESILKFFEILSPVYRFDKECFKCALGSSWIISVELAIGPEEGISYLTDKGCNPTHLADFTQVQTIQYSNSEDKDRKGMLQLKIAGAPEPLTVTAPSLTIAENMADLIDGYCRLVNGTS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue Total RNA, Liver
CR561082 5 µg

Tissue Total RNA, Liver

Sign In for Pricing
View Details
TentaGel® MB NH₂
MB160002.5G 5 g

TentaGel® MB NH₂

Sign In for Pricing
View Details
Mouse IgG (H+L), AlpHcAbs® Goat antibody
HA710144 100 µg

Mouse IgG (H+L), AlpHcAbs® Goat antibody

Sign In for Pricing
View Details
Recombinant Collagen VI alpha 1/Collagen VI alpha 2/Collagen VI alpha 3 Antibody
RC-15254-01 50 μL

Recombinant Collagen VI alpha 1/Collagen VI alpha 2/Collagen VI alpha 3 Antibody

Sign In for Pricing
View Details
Recombinant Collagen VI alpha 1/Collagen VI alpha 2/Collagen VI alpha 3 Antibody
RC-15254-02 100 µL

Recombinant Collagen VI alpha 1/Collagen VI alpha 2/Collagen VI alpha 3 Antibody

Sign In for Pricing
View Details
Recombinant Collagen VI alpha 1/Collagen VI alpha 2/Collagen VI alpha 3 Antibody
RC-15254-03 1 mL

Recombinant Collagen VI alpha 1/Collagen VI alpha 2/Collagen VI alpha 3 Antibody

Sign In for Pricing
View Details