Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Protein kinase C zeta type (KPCZ), Biotinylated

This Recombinant Human Protein kinase C zeta type (KPCZ), Biotinylated spans the amino acid sequence from region 1-592. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Protein kinase C zeta type; EC 2.7.11.13; nPKC-zeta; PRKCZ PKC2

UniProt

Q05513

Expression Region

1-592

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MPSRTGPKMEGSGGRVRLKAHYGGDIFITSVDAATTFEELCEEVRDMCRLHQQHPLTLKWVDSEGDPCTVSSQMELEEAFRLARQCRDEGLIIHVFPSTPEQPGLPCPGEDKSIYRRGARRWRKLYRANGHLFQAKRFNRRAYCGQCSERIWGLARQGYRCINCKLLVHKRCHGLVPLTCRKHMDSVMPSQEPPVDDKNEDADLPSEETDGIAYISSSRKHDSIKDDSEDLKPVIDGMDGIKISQGLGLQDFDLIRVIGRGSYAKVLLVRLKKNDQIYAMKVVKKELVHDDEDIDWVQTEKHVFEQASSNPFLVGLHSCFQTTSRLFLVIEYVNGGDLMFHMQRQRKLPEEHARFYAAEICIALNFLHERGIIYRDLKLDNVLLDADGHIKLTDYGMCKEGLGPGDTTSTFCGTPNYIAPEILRGEEYGFSVDWWALGVLMFEMMAGRSPFDIITDNPDMNTEDYLFQVILEKPIRIPRFLSVKASHVLKGFLNKDPKERLGCRPQTGFSDIKSHAFFRSIDWDLLEKKQALPPFQPQITDDYGLDNFDTQFTSEPVQLTPDDEDAIKRIDQSEFEGFEYINPLLLSTEESV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CCK4 / PTK7 Positive Control
MBS542603-01 5 Applications

CCK4 / PTK7 Positive Control

Sign In for Pricing
View Details
CCK4 / PTK7 Positive Control
MBS542603-02 5x 5 Applications

CCK4 / PTK7 Positive Control

Sign In for Pricing
View Details
ARP-1 Lentiviral Activation Particles (m)
sc-419169-LAC 200 µL

ARP-1 Lentiviral Activation Particles (m)

Sign In for Pricing
View Details
Lentiviral human AAK1 shRNA (UAS) - Lentiviral human AAK1 shRNA (UAS, RFP) plasmid
GTR15330700 1 Vial

Lentiviral human AAK1 shRNA (UAS) - Lentiviral human AAK1 shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
DYNLRB2 Blocking Peptide
MBS9628493-01 1 mg

DYNLRB2 Blocking Peptide

Sign In for Pricing
View Details
DYNLRB2 Blocking Peptide
MBS9628493-02 5x 1 mg

DYNLRB2 Blocking Peptide

Sign In for Pricing
View Details