Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit alpha (P2R3A), partial, Biotinylated

This Recombinant Human Serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit alpha (P2R3A), partial, Biotinylated spans the amino acid sequence from region 758-793. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit alpha; PP2A subunit B isoform PR72/PR130; PP2A subunit B isoform R3 isoform; PP2A subunit B isoforms B''-PR72/PR130; PP2A subunit B isoforms B72/B130; Serine/threonine-protein phosphatase 2A 72/130 kDa regulatory subunit B; PPP2R3A PPP2R3

UniProt

Q06190

Expression Region

758-793

Origin

Homo sapiens (Human)

Field of Research

Pharmacology & Drug Discovery

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

CPLYWKAPMFRAAGGEKTGFVTAQSFIAMWRKLLNN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MAST2 Antibody
E18-0571-2 100 µg -100 µL

MAST2 Antibody

Sign In for Pricing
View Details
FSIP1 Mouse Monoclonal Antibody [Clone:5E10]
E45M17208 100 µg

FSIP1 Mouse Monoclonal Antibody [Clone:5E10]

Sign In for Pricing
View Details
((2-Morpholin-4-ylethyl) amino) (phenylamino) methane-1-thione
FM168954-01 1 g

((2-Morpholin-4-ylethyl) amino) (phenylamino) methane-1-thione

Sign In for Pricing
View Details
((2-Morpholin-4-ylethyl) amino) (phenylamino) methane-1-thione
FM168954-02 2 g

((2-Morpholin-4-ylethyl) amino) (phenylamino) methane-1-thione

Sign In for Pricing
View Details
((2-Morpholin-4-ylethyl) amino) (phenylamino) methane-1-thione
FM168954-03 5 g

((2-Morpholin-4-ylethyl) amino) (phenylamino) methane-1-thione

Sign In for Pricing
View Details
((2-Morpholin-4-ylethyl) amino) (phenylamino) methane-1-thione
FM168954-04 10 g

((2-Morpholin-4-ylethyl) amino) (phenylamino) methane-1-thione

Sign In for Pricing
View Details