Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human E3 ubiquitin-protein ligase RING1 (RING1), Biotinylated

This Recombinant Human E3 ubiquitin-protein ligase RING1 (RING1), Biotinylated spans the amino acid sequence from region 1-406. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

E3 ubiquitin-protein ligase RING1; EC 2.3.2.27; Polycomb complex protein RING1; RING finger protein 1; RING-type E3 ubiquitin transferase RING1; Really interesting new gene 1 protein; RING1 RING1A RNF1

UniProt

Q06587

Expression Region

1-406

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin; Molecular Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MTTPANAQNASKTWELSLYELHRTPQEAIMDGTEIAVSPRSLHSELMCPICLDMLKNTMTTKECLHRFCSDCIVTALRSGNKECPTCRKKLVSKRSLRPDPNFDALISKIYPSREEYEAHQDRVLIRLSRLHNQQALSSSIEEGLRMQAMHRAQRVRRPIPGSDQTTTMSGGEGEPGEGEGDGEDVSSDSAPDSAPGPAPKRPRGGGAGGSSVGTGGGGTGGVGGGAGSEDSGDRGGTLGGGTLGPPSPPGAPSPPEPGGEIELVFRPHPLLVEKGEYCQTRYVKTTGNATVDHLSKYLALRIALERRQQQEAGEPGGPGGGASDTGGPDGCGGEGGGAGGGDGPEEPALPSLEGVSEKQYTIYIAPGGGAFTTLNGSLTLELVNEKFWKVSRPLELCYAPTKDPK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PD-L1 / PDCD1LG1 / CD274 / B7-H1 (Cancer Immunotherapy Target) (PDL1/2745), CF568 conjugate, 0.1mg/mL
BNC682745-500 1x 500 µL

PD-L1 / PDCD1LG1 / CD274 / B7-H1 (Cancer Immunotherapy Target) (PDL1/2745), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human CEP70 activation kit by CRISPRa
GA112922 1 Kit

Human CEP70 activation kit by CRISPRa

Sign In for Pricing
View Details
(7E,9E)-beta-Ionylidene Acetaldehyde
TRC-I734000-25MG 25 mg

(7E,9E)-beta-Ionylidene Acetaldehyde

Sign In for Pricing
View Details
Ninein Recombinant Rabbit Monoclonal Antibody [PSH03-46]
HA722005 100 µL

Ninein Recombinant Rabbit Monoclonal Antibody [PSH03-46]

Sign In for Pricing
View Details
SCAND1 (NM_016558) Human Recombinant Protein
TP304370 20 µg

SCAND1 (NM_016558) Human Recombinant Protein

Sign In for Pricing
View Details
Protein A Coated - 96 well plates - 8 Well Strips on 12 x 8 frame - Clear PS
MT06F4-PA 10x 96 Well Plates

Protein A Coated - 96 well plates - 8 Well Strips on 12 x 8 frame - Clear PS

Sign In for Pricing
View Details